Clone BO28934 Report

Search the DGRC for BO28934

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptCG43110-RA
Protein status:BO28934.pep: Imported from assembly
Sequenced Size:1483

Clone Sequence Records

BO28934.complete Sequence

1483 bp assembled on 2011-08-24

GenBank Submission: KX799702

> BO28934.complete
GAAGTTATCAGTCGACATGACGTATCTTTTTGTGTGGATTTTTTTGTGCT
CATTGGGATCTTGCCAGTTGGCGTATTCCATGTTTTTGAAGCAGCCCTGT
GGAAAAACACCAGTCCCGAAAATTATTTCAGGCTCAAACGCAAGTCAACA
AAGTGCTCAGTATATGGCAGGCATTTTTAATACAACACATTTGTTGTGCG
GCGGCACGATTATTCACGAAGATTTTGTTTTAACGGTTGCTCATTGCAAA
AGTACACAAACGCTATTCGTGAGACTTGGAGCGTACAACATTAATCACCC
GACCGATCAGATTCGCGTAATCGAAACTATAGCCCATCCACAATACAGCA
ATTCCACTTATGCCAACGATATAGCCCTGGTGAAGTTGGAGAGGAGTGTG
ATATTTAACCTTAATATTCAACCAATATGCATTCACTTGGACGCAACATT
GGGCAAACAAATACGCTATTATAATGCCTTTGGATGGGGAAGAACAAGAA
ATGCCGAGCAAAGCGATATACTTCAAAGAATTTTTGTTAATCGAACCAAC
CCAATGATATGCCATCTCTATTTGGGAATGAGTCCCGATCCGAAACAGAT
ATGTGCGACTACCGACCAAGGAGATACATGTGCCGGCGATTCTGGCGGTC
CGTTGATCAGCAAAATTACTTACCAGGGGAAGAATTTCGATACACAGTTC
GGGATTACCAGTTATGGCACCAGGGAATGCAATGGAGTTGGTCTCTATAC
CGATGTCTCACAGTATAGTGGCTGGATTGCAAATATAGTTAGGAGCAAAC
AGGATCGTAGTGTGGTCAGTAGGAGGAGCAACGGTATGTTTCTGTATTCT
GACTGCACTGGCGATTCCATCGGATCCATTCTAATGGCAACCATCGTTGG
ACTTCAATACTCCGCGAAGGGTGTACTGATCACCGACCGCCATGTCCTAA
CCACTGCGGACTTTTCCCAAGACAACCCCTTCTCCTTAGCCATTGTTGTG
ATGGGTATGGAATTCCAAGCTAGCGCGATTTTTAAGCCGTTTGCGGACAT
TAACATATCACTGATTAGCCTGACGCGTCGGTTGGAAAACAGAGGTGCAT
TGAGACCGATCTGCATTCTGGAAACTGCAAACATCGCTGGTTCTTTAAGA
ATCACTGGCACAGGTCAATATGGCTTAAGCAATTACGTTATAAATGTGCA
AAGCCTTAATTGGCAGTTGTGTGAACTTGAGTTGAGGAGAAATATCGAAC
AGAATCAGTTTTGTGTGAAAAACACTTTCCAACCAAATGCGCTTAAGCAA
TTTGGTACAGCTGGCGATATATTGGTTAAAAAAATATTGAATGTTTCGGG
CATGGTCCATTTCGTTCTATTGGGCTTGGTAGACGTTTCGCACAATGACG
TATACGTAATAACCAGTGCTATGGCAAATGCAGAATGGATCTCGAAAATA
GTAAATCAGAATGAAGCAAGCTTTCTAGACCAT

BO28934.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-RA 1452 CG43110-PA 1..1449 17..1465 7245 100 Plus
CG43110-RB 1452 CG43110-PB 1..1449 17..1465 7245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-RA 1671 CG43110-RA 24..1475 14..1465 7260 100 Plus
CG43110-RB 8272 CG43110-RB 2192..3643 14..1465 7260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17482905..17483433 939..411 2645 100 Minus
2R 25286936 2R 17482194..17482566 1465..1093 1865 100 Minus
2R 25286936 2R 17483822..17484029 221..14 1040 100 Minus
2R 25286936 2R 17483492..17483637 410..265 730 100 Minus
2R 25286936 2R 17482617..17482725 1096..988 545 100 Minus
2R 25286936 2R 17482791..17482839 987..939 245 100 Minus
2R 25286936 2R 17483698..17483742 264..220 225 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:10:28 has no hits.

BO28934.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:00 Download gff for BO28934.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RA 1..1449 17..1467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:54:00 Download gff for BO28934.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RA 27..1475 17..1467 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:49 Download gff for BO28934.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RB 2195..3643 17..1467 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:12:49 Download gff for BO28934.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17483822..17484026 17..221 100   Minus
2R 17483698..17483740 222..264 100 <- Minus
2R 17483492..17483637 265..410 100 <- Minus
2R 17482906..17483433 411..938 100 <- Minus
2R 17482791..17482839 939..987 100 <- Minus
2R 17482619..17482725 988..1094 100 <- Minus
2R 17482192..17482564 1095..1467 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:54:00 Download gff for BO28934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13371327..13371531 17..221 100   Minus
arm_2R 13371203..13371245 222..264 100 <- Minus
arm_2R 13370997..13371142 265..410 100 <- Minus
arm_2R 13370411..13370938 411..938 100 <- Minus
arm_2R 13370296..13370344 939..987 100 <- Minus
arm_2R 13370124..13370230 988..1094 100 <- Minus
arm_2R 13369697..13370069 1095..1467 99 <- Minus

BO28934.pep Sequence

Translation from 16 to 1483

> BO28934.pep
MTYLFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYM
AGIFNTTHLLCGGTIIHEDFVLTVAHCKSTQTLFVRLGAYNINHPTDQIR
VIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIR
YYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTD
QGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQY
SGWIANIVRSKQDRSVVSRRSNGMFLYSDCTGDSIGSILMATIVGLQYSA
KGVLITDRHVLTTADFSQDNPFSLAIVVMGMEFQASAIFKPFADINISLI
SLTRRLENRGALRPICILETANIAGSLRITGTGQYGLSNYVINVQSLNWQ
LCELELRRNIEQNQFCVKNTFQPNALKQFGTAGDILVKKILNVSGMVHFV
LLGLVDVSHNDVYVITSAMANAEWISKIVNQNEASFLDH

BO28934.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-PA 483 CG43110-PA 1..483 1..483 2518 100 Plus
CG43110-PB 483 CG43110-PB 1..483 1..483 2518 100 Plus
CG30187-PD 451 CG30187-PD 1..451 50..482 659 35.4 Plus
CG30187-PC 440 CG30187-PC 1..440 50..482 626 34.6 Plus
CG10764-PA 523 CG10764-PA 25..516 23..479 596 32 Plus