Clone BO28936 Report

Search the DGRC for BO28936

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptMf-RF
Protein status:BO28936.pep: Imported from assembly
Sequenced Size:973

Clone Sequence Records

BO28936.complete Sequence

973 bp assembled on 2011-08-24

GenBank Submission: KX797589

> BO28936.complete
GAAGTTATCAGTCGACATGTTCAAAAACCACTTGGAAATGATTGGGCGCA
ATGAGAGCCCCAGCAAGAAGGCGAAATTCTGGCAGTCCTACATCAGGTCC
CTGAAGGGCTCCGAGGATATCCGTGCCCACGAGGCGCCCCGTGCCTCTCG
TCCCTACAGCTCCTACCTGGACTCGCCCTCCTACAGGAGCATCTATGACG
AGCCCGCCACCGCCAATGAGCGCGTCCAGTCCTCTGGCTACAGATATCTG
CCAGTGAGCCGCGACACCTACGGCTACTCGCCCCGTGCCATCTACGATCA
TCACTACAGCCGAACAATTCCAGCTAACTACGACGCAGAGAAGGCCTGGA
ATGATCATCTGAAGCGCATGCAGGAGATCGAGCGCAGGTACCCATCTCGC
TATGGTCTCTACTTGAGGGACAAGCCACTCACGCCCAACTCGCTGGTGCC
CCTGGAGTACGAGCCAGAGGACAAGCTGCTGGCTGAGCTCAACAAGGCTC
GTCGCTCGGCCTCGCCGTTCCGCCCTGCCAGGACGACCCGTGCCGGCAGC
GAGCCGTACGTGCCACCGCCGAGCTACTGGAACCGCGAGGGCAGCGTGCC
ACGCGGAGGACCCTCGGTCTTCGATCGTGCCACCAGCTTGGCCCCGTTCA
CGCGGCCCAGCTTCCGTGCCAGCTCCCTGGAGCCGCTGGACGAACTCTTT
GAACGACTCCCCATCTTTCACCCACGCAACCGCTTCAGGGATCTGCTGAG
CCCCAGCCCCAACTTGCCGATCTCCTCGATTGTGCGCGATCCCTTCTGGT
GGGACGTGGATGACCTGGTGCCCTTCCGCGCCACCTCGGTGCCCCGTGCC
TCGAGCCCCGTGGCCCGGGATTCGTACTTGTCGCCGGTGAAGAACCGCTA
CTTGTGGTCCAAGCACCCAGCTAGACCCTTGACACCTGAGGAAGAGGATT
TATTCGCAAGCTTTCTAGACCAT

BO28936.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RJ 942 CG6803-PJ 1..939 17..955 4695 100 Plus
Mf-RF 942 CG6803-PF 1..939 17..955 4695 100 Plus
Mf-RD 939 CG6803-PD 1..921 17..937 4605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RJ 1954 CG6803-RJ 115..1053 17..955 4695 100 Plus
Mf-RF 2020 CG6803-RF 181..1119 17..955 4695 100 Plus
Mf-RD 1783 CG6803-RD 115..1035 17..937 4605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15172600..15172830 935..705 1155 100 Minus
3R 32079331 3R 15178280..15178490 317..107 1055 100 Minus
3R 32079331 3R 15174136..15174344 705..497 1045 100 Minus
3R 32079331 3R 15176184..15176295 497..386 560 100 Minus
3R 32079331 3R 15179038..15179129 108..17 460 100 Minus
3R 32079331 3R 15176362..15176437 389..314 365 98.7 Minus
Blast to na_te.dros performed on 2014-11-26 16:11:51 has no hits.

BO28936.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:01 Download gff for BO28936.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RJ 120..1053 22..957 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:54:38 Download gff for BO28936.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 186..1119 22..957 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:21 Download gff for BO28936.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 186..1119 22..957 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:13:21 Download gff for BO28936.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15179039..15179124 22..107 100   Minus
3R 15178280..15178489 108..317 100 <- Minus
3R 15176364..15176433 318..387 100 <- Minus
3R 15176184..15176293 388..497 100 <- Minus
3R 15174137..15174343 498..704 100 <- Minus
3R 15172600..15172830 705..935 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:54:38 Download gff for BO28936.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11004761..11004846 22..107 100   Minus
arm_3R 11004002..11004211 108..317 100 <- Minus
arm_3R 11002086..11002155 318..387 100 <- Minus
arm_3R 11001906..11002015 388..497 100 <- Minus
arm_3R 10999859..11000065 498..704 100 <- Minus
arm_3R 10998322..10998552 705..935 100 <- Minus

BO28936.pep Sequence

Translation from 16 to 973

> BO28936.pep
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
IPANYDAEKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEP
EDKLLAELNKARRSASPFRPARTTRAGSEPYVPPPSYWNREGSVPRGGPS
VFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRFRDLLSPSPNL
PISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH
PARPLTPEEEDLFASFLDH

BO28936.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PJ 313 CG6803-PJ 1..313 1..313 1678 100 Plus
Mf-PF 313 CG6803-PF 1..313 1..313 1678 100 Plus
Mf-PD 312 CG6803-PD 1..312 1..312 1648 98.7 Plus
Mf-PO 310 CG6803-PO 1..310 1..312 1620 97.8 Plus
Mf-PB 365 CG6803-PB 1..365 1..313 1615 85.8 Plus