Clone BO28943 Report

Search the DGRC for BO28943

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG32428-RC
Protein status:BO28943.pep: Imported from assembly
Sequenced Size:768

Clone Sequence Records

BO28943.complete Sequence

768 bp assembled on 2011-09-14

> BO28943.complete
GAAGTTATCAGTCGACATGGTTTTGACGAACTTCGAGTGCTGGGCACATG
GTGATCCGTCGTCGTCGGCGGCCGCCACTTTCGAAACTGGAGCGCTGCGT
CCTTCGATGGATCCGTTCAATCCACGCGCCGTCACCTTCATGACCGACGC
CAACAACAACAACAACAACAATGATGGCAATAACCTCGCGGCACAACCGA
TGCCGGTCGTCCTGCCTCCGGAAGTCCTGCGCTGCAAGAAGCGCCTGAAT
CCCGGTCACAATCCTGTCGGGGATTTGGACACGGACCAACCGGTGTACAC
CAAGAGATGTCGCTACGACGAGTCTGACTTGGCCGCCCAGTACTGCAATG
ATTTCTTTTCCTTGCCTGCCACACAAATAATTGGAACGCAGGCCTCTTTG
ATGGATTACGAGATGCAGGCCACCGGCGGCATGATGATGATGGAATCGGA
GACGAGTTTTCCAGCGCAGCAGCAGCAACATCAAGAGCAACAGCAACATC
CACAGCAGCCACATCAATATCAGCGCATTCATCAGCATTATCAAGAATCC
GCAGAGCAACGAGTGCCGTCCCCGCAGCAAAAGTCAAGAAAATCTAATAA
TTCTATTGGGAAAATCAAATTAAAGTCCATAGGCAGCGAAGCCGAAGCGG
ACTTGTATATAGCCACACACGGCGGCAGTCTGCACCACTTTTGTGGGCTC
GGCGGATCGGAGCTAGAGGAGTCTGATATAGCAAGCTTTCTAGACCATTC
GTTTGGGGCGCGAAAGGG

BO28943.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-RC 717 CG32428-PC 1..714 17..730 3570 100 Plus
CG32428-RB 588 CG32428-PB 1..529 17..545 2645 100 Plus
CG32428-RA 588 CG32428-PA 1..529 17..545 2645 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-RC 1238 CG32428-RC 399..1112 17..730 3570 100 Plus
CG32428-RB 1804 CG32428-RB 345..873 17..545 2645 100 Plus
CG32428-RA 1213 CG32428-RA 399..927 17..545 2645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20472641..20472974 350..17 1670 100 Minus
3L 28110227 3L 20470954..20471149 545..350 980 100 Minus
3L 28110227 3L 20469800..20469986 730..544 935 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:22:24 has no hits.

BO28943.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:48 Download gff for BO28943.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 356..1069 17..730 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:21 Download gff for BO28943.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 399..1112 17..730 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:18 Download gff for BO28943.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 399..1112 17..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:18 Download gff for BO28943.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20472641..20472974 17..350 100   Minus
3L 20470954..20471148 351..545 100 <- Minus
3L 20469800..20469984 546..730 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:21 Download gff for BO28943.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20465741..20466074 17..350 100   Minus
arm_3L 20464054..20464248 351..545 100 <- Minus
arm_3L 20462900..20463084 546..730 100 <- Minus

BO28943.pep Sequence

Translation from 16 to 766

> BO28943.pep
MVLTNFECWAHGDPSSSAAATFETGALRPSMDPFNPRAVTFMTDANNNNN
NNDGNNLAAQPMPVVLPPEVLRCKKRLNPGHNPVGDLDTDQPVYTKRCRY
DESDLAAQYCNDFFSLPATQIIGTQASLMDYEMQATGGMMMMESETSFPA
QQQQHQEQQQHPQQPHQYQRIHQHYQESAEQRVPSPQQKSRKSNNSIGKI
KLKSIGSEAEADLYIATHGGSLHHFCGLGGSELEESDIASFLDHSFGARK

BO28943.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-PC 238 CG32428-PC 1..238 1..238 1277 100 Plus
CG32428-PB 195 CG32428-PB 1..176 1..176 961 100 Plus
CG32428-PA 195 CG32428-PA 1..176 1..176 961 100 Plus