Clone BO28953 Report

Search the DGRC for BO28953

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG42690-RA
Protein status:BO28953.pep: Imported from assembly
Sequenced Size:445

Clone Sequence Records

BO28953.complete Sequence

445 bp assembled on 2011-08-24

GenBank Submission: KX793820

> BO28953.complete
GAAGTTATCAGTCGACATGTGCTGCAATGCCAACCGCCAGCTATTATGTA
TCTTTACCGGAGCATTGGCGATACTGATATCAACTTTATGTTTAGGATTC
ATGCTTTACCGGCTAGGCACGACTGGTATAAACCATTGGGAGGAGGCGTA
CCTGGTAGCCTGGGCTGTCATTATTTTAGCAGCGGTACCTCTAATTGTAG
GAGCAATAAAAGAAATTCGCTATCTTTTGGTGATTTGGATAGTAGTCGCT
TTAATAAGCGGCATTTCTCTGATAGTTATTCAAATAGAAATGTTTCATAG
CTTTTTTCATAAGGATCCTGATACAGCCTTTCATATTCTCGGTGGTATAG
TCATTATAGTTTTCGTATTATTGCTCTGCTGTTTTCTATACTTCCCATAT
ACGTATGCGCGTGAGCTGGAAGGAGATGCAAGCTTTCTAGACCAT

BO28953.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42690-RB 414 CG42690-PB 1..411 17..427 2055 100 Plus
CG42690-RA 414 CG42690-PA 1..411 17..427 2055 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43195-RA 1281 CG43195-RA 198..608 17..427 2055 100 Plus
CG42690-RB 1286 CG42690-RB 198..608 17..427 2055 100 Plus
CG42690-RA 761 CG42690-RA 198..608 17..427 2055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19945230..19945386 368..212 785 100 Minus
2R 25286936 2R 19945580..19945680 117..17 505 100 Minus
2R 25286936 2R 19945438..19945536 212..114 495 100 Minus
2R 25286936 2R 19945111..19945169 427..369 295 100 Minus
Blast to na_te.dros performed 2014-11-26 16:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 2896..2975 418..335 105 60.7 Minus

BO28953.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:11 Download gff for BO28953.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 10..420 17..429 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:57:49 Download gff for BO28953.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 10..420 17..429 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:15 Download gff for BO28953.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 198..608 17..429 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:15 Download gff for BO28953.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19945581..19945680 17..116 100   Minus
2R 19945439..19945533 117..211 100 <- Minus
2R 19945230..19945386 212..368 100 <- Minus
2R 19945109..19945169 369..429 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:57:49 Download gff for BO28953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15833086..15833185 17..116 100   Minus
arm_2R 15832944..15833038 117..211 100 <- Minus
arm_2R 15832735..15832891 212..368 100 <- Minus
arm_2R 15832614..15832674 369..429 96 <- Minus

BO28953.pep Sequence

Translation from 16 to 445

> BO28953.pep
MCCNANRQLLCIFTGALAILISTLCLGFMLYRLGTTGINHWEEAYLVAWA
VIILAAVPLIVGAIKEIRYLLVIWIVVALISGISLIVIQIEMFHSFFHKD
PDTAFHILGGIVIIVFVLLLCCFLYFPYTYARELEGDASFLDH

BO28953.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42690-PB 137 CG42690-PB 1..137 1..137 713 100 Plus
CG42690-PA 137 CG42690-PA 1..137 1..137 713 100 Plus
CG42691-PA 140 CG42691-PA 1..135 1..135 336 48.1 Plus
CG43195-PA 138 CG43195-PA 1..133 1..135 238 35.6 Plus
CG43195-PB 129 CG43195-PB 1..124 1..135 199 33.3 Plus