Clone BO28954 Report

Search the DGRC for BO28954

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG43120-RA
Protein status:BO28954.pep: Imported from assembly
Sequenced Size:892

Clone Sequence Records

BO28954.complete Sequence

892 bp assembled on 2011-08-24

GenBank Submission: KX798049

> BO28954.complete
GAAGTTATCAGTCGACATGAGCACCTCACTAAGATCCAGCCGAGGAATCA
AGCTTATGAAGTCGGGCCATTTCTCAGATGTATGCATTCGCATAGATTGT
ATTAGCTTCCGGTGCCACAAAATCATCTTAGCCTGTGCTTCTGAGTTTTT
TGAGAGATTATTTCAAGAAGATTCGGAGGAATTTTTGTTAGATGGAACAA
CCCCAGAAGTTTTTCAGATATTTCTTGATTTTATATACGCTCCTAACGAT
GACCAATTCGGCAATCTTGAACCGGATGTATTGATGTGTCTTCTGAAGTG
CGCAAATATGTGGCTCGCTGTGGAAATAGAAGAAAGATGCATCGACATTC
TATTAGATCTATCCCCTGACATGGATCCGGATGCCCTTATTGCACTTTTT
GCAGTGTCGCATTGTGTGGATCACAAAGTATTAATGGAACAGTCTATTGG
AGTCCTGCAACATATATGGAGAAACGAAATGGACTGTCCATCAACTGTCA
GAATGGAAGTCGACTGCTTCGGAGAATATTTTAAAAACACCTCGGGAATG
CTTTCTCCGCGTAGGCGCTTTGTCATGGTGGAAAACTGGATAAAAGGCAA
TGATTTGAATAATAGACCGTGCTCTCAAAAAGATAAAATTAACCAAATTA
TTAAGAGCATTAACTTTTTGGAAATGTCATTGGAGGACTTTTACAATGGT
CCAGGAAAGTCTAACGTTTTGCCCGATTCAGACAAGTTCGAAATAATGTA
TAAACTTGCCCGTTCAAATAATGAATGGACTGTTATATTGGACGAAAGGG
ATCGAGATAGGTACTACATAATTGTTTTTGTGAAGAAGAAGTCGACTAAA
TTTGTGTTTTATTTAAAGTTGATAGCAAGCTTTCTAGACCAT

BO28954.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-RA 861 CG43120-PA 1..858 17..874 4290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-RA 1270 CG43120-RA 53..910 17..874 4290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14382517..14382939 452..874 2115 100 Plus
3L 28110227 3L 14382048..14382469 32..453 2110 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:19:35 has no hits.

BO28954.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:12 Download gff for BO28954.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 53..910 17..876 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:58:00 Download gff for BO28954.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 53..910 17..876 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:27 Download gff for BO28954.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 53..910 17..876 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:27 Download gff for BO28954.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14382517..14382939 452..876 99   Plus
3L 14382050..14382467 34..451 100 -> Plus
3L 14381965..14381981 17..33 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:58:00 Download gff for BO28954.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14375617..14376039 452..876 99   Plus
arm_3L 14375150..14375567 34..451 100 -> Plus
arm_3L 14375065..14375081 17..33 100 -> Plus

BO28954.pep Sequence

Translation from 16 to 892

> BO28954.pep
MSTSLRSSRGIKLMKSGHFSDVCIRIDCISFRCHKIILACASEFFERLFQ
EDSEEFLLDGTTPEVFQIFLDFIYAPNDDQFGNLEPDVLMCLLKCANMWL
AVEIEERCIDILLDLSPDMDPDALIALFAVSHCVDHKVLMEQSIGVLQHI
WRNEMDCPSTVRMEVDCFGEYFKNTSGMLSPRRRFVMVENWIKGNDLNNR
PCSQKDKINQIIKSINFLEMSLEDFYNGPGKSNVLPDSDKFEIMYKLARS
NNEWTVILDERDRDRYYIIVFVKKKSTKFVFYLKLIASFLDH

BO28954.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-PA 286 CG43120-PA 1..286 1..286 1516 100 Plus
CG11714-PC 371 CG11714-PC 31..304 30..250 246 24.5 Plus
CG11714-PD 383 CG11714-PD 43..316 30..250 246 24.5 Plus
CG11714-PA 383 CG11714-PA 43..316 30..250 246 24.5 Plus