Clone BO28959 Report

Search the DGRC for BO28959

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptCG1308-RE
Protein status:BO28959.pep: Imported from assembly
Sequenced Size:799

Clone Sequence Records

BO28959.complete Sequence

799 bp assembled on 2011-08-24

GenBank Submission: KX799857

> BO28959.complete
GAAGTTATCAGTCGACATGGACAATAAGAAGGATATATACAATCTGTGGG
TGCAGTACACGACAAAGAATGATGAAACCCACTTCCGGCAATTTGTGGCC
CGCTTCGTGGCCATTTGGAGGAGCCAACTGCAGCTAGACTTTCAGGCGGA
AAATTGCCCGATGTGGCACGAGGTTCAGCCGGATAGTGGTCCCCACTTGG
GCCGCCTCCCGGATGAACTCCTGCCCGCCATCGGTAAATTCATCATTGTA
GCCAGAGATGTTTGCGAAACGGAAGGGAAACTGGAGGAGCAGGCCATTGA
AGAAGTAGCCATACTCGTGGATTGTCTGGTGATCGTGTGCCGGCACTTTG
ATAACATACTGTCCATCATCAAGTATGAATACAAGCCGAATTTGATCGCC
ATACTCTCCAGGGTGTTCAAACAACAAATGGAGCTGCCGCAGAGCGTGCC
CGCAATAAGCCACCTGTTTAGCAGTTTCTCGGCATTCCTGGAAGTCATGT
ATGATCCATATCTGACGTGGCGCAGCTTCGTGCGAGGCCAGTCAGCTGAC
TACAGTCGTCTTTCATATAAACCCCACTCGGTTCATGTGGAAATTGTCCC
CTTTATTTATGATTGCTTTCAGGAGGAGAAGCTCATCCGATATGCGGAAA
TTGGCGAAAGCCTGCTAAACATCCTGGGCGCTGTGATTTGCGGCTCACAG
GTAGCGCCAGAAAGCGTCTCCAGTCCCTTCCTGTGTAGTCCTTTCTCTCT
TAAAAACCGTTTAATTATTAACCTCACTTCCGCAAGCTTTCTAGACCAT

BO28959.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-RD 8139 CG43367-PD 1..684 17..700 3420 100 Plus
CG43367-RC 8265 CG43367-PC 1..684 17..700 3420 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-RE 10170 CG43367-RE 293..1057 17..781 3825 100 Plus
CG43367-RF 9817 CG43367-RF 1..704 78..781 3520 100 Plus
CG43367-RD 9842 CG43367-RD 293..976 17..700 3420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4194555..4194914 65..424 1800 100 Plus
3L 28110227 3L 4194978..4195164 425..611 935 100 Plus
3L 28110227 3L 4195298..4195468 611..781 855 100 Plus
3L 28110227 3L 4194285..4194335 17..67 255 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:55:07 has no hits.

BO28959.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:51 Download gff for BO28959.complete
Subject Subject Range Query Range Percent Splice Strand
CG1308-RE 293..1057 17..783 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:52 Download gff for BO28959.complete
Subject Subject Range Query Range Percent Splice Strand
CG43367-RE 293..1057 17..783 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:58 Download gff for BO28959.complete
Subject Subject Range Query Range Percent Splice Strand
CG43367-RE 293..1057 17..783 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:58 Download gff for BO28959.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4195299..4195468 612..783 98   Plus
3L 4194978..4195164 425..611 100 -> Plus
3L 4194558..4194914 68..424 100 -> Plus
3L 4194285..4194335 17..67 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:52 Download gff for BO28959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4195299..4195468 612..783 98   Plus
arm_3L 4194978..4195164 425..611 100 -> Plus
arm_3L 4194558..4194914 68..424 100 -> Plus
arm_3L 4194285..4194335 17..67 100 -> Plus

BO28959.pep Sequence

Translation from 16 to 799

> BO28959.pep
MDNKKDIYNLWVQYTTKNDETHFRQFVARFVAIWRSQLQLDFQAENCPMW
HEVQPDSGPHLGRLPDELLPAIGKFIIVARDVCETEGKLEEQAIEEVAIL
VDCLVIVCRHFDNILSIIKYEYKPNLIAILSRVFKQQMELPQSVPAISHL
FSSFSAFLEVMYDPYLTWRSFVRGQSADYSRLSYKPHSVHVEIVPFIYDC
FQEEKLIRYAEIGESLLNILGAVICGSQVAPESVSSPFLCSPFSLKNRLI
INLTSASFLDH

BO28959.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-PC 2754 CG1308-PB 1..255 1..257 1210 92.2 Plus
CG43367-PD 2712 CG43367-PD 1..241 1..235 1203 95.9 Plus