Clone BO28962 Report

Search the DGRC for BO28962

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG34433-RB
Protein status:BO28962.pep: Imported from assembly
Sequenced Size:690

Clone Sequence Records

BO28962.complete Sequence

690 bp assembled on 2011-08-24

> BO28962.complete
GAAGTTATCAGTCGACATGTCTGGAGCGGAGTCCCTTTTTACTTGGGTGT
ACGGACCGGGTGTCACGCGAGGGGGCAGTGTGGTGGGGCATCATCAGCCC
GAGGCCCTGCGACCCGTGCTCTTTCTGTTCTATACCCTGGAAACCATCTT
CAACATGTTCTGCATGGGATATCACATCTCGGGCTTTCAGGCCATCGAAT
TGCATGTGTTCGAATGGGATACGAGCGTCAATATATGCACAGGTAACACA
CCCGCCGTCGTCACGGAGATCTGGAAGTCCTCGGCGGCAGCCATCGTCTT
TATCCTGATATCCTTGAGCACAATGTGGGACGCGGAGCGGCAGTTTTACG
TGTTCTTTTTTGCGAGCGAGCTTGGCGATAAGAATTCACATGCATTTGTG
GAAGACCGCCCAATACACCCGATCTTCCACTACCTTCGTGGTATGTCCAT
CTCCTCGCTGACCTGCGGAATACTCTACCTGCTGCACGCCACTATCATGA
TCGACGTCAAGCTTACCAATGACCGGAACCAAGGAGAGAGCAAGGGTACC
TATATGCCCATACCTCTTTTCGTCCTGGGGCGATTCATCCACAGGAAACT
AAGCGCCTACGATTGGTTTCGGGAGTTCTGCGAGAACGATATCATTTACT
TGGCAAGCTTTCTAGACCATTCGTGGGGCCCGCAAAGGGG

BO28962.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34433-RB 639 CG34433-PB 1..636 17..652 3180 100 Plus
CG34433-RA 702 CG34433-PA 270..699 223..652 2150 100 Plus
CG34433-RA 702 CG34433-PA 1..207 17..223 1035 100 Plus
CG34432-RA 642 CG34432-PA 264..356 265..357 195 80.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34433-RB 835 CG34433-RB 8..643 17..652 3180 100 Plus
CG34433-RA 898 CG34433-RA 277..706 223..652 2150 100 Plus
CG34433-RA 898 CG34433-RA 8..214 17..223 1035 100 Plus
CG34432-RA 723 CG34432-RA 280..372 265..357 195 80.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30650237..30650666 223..652 2150 100 Plus
3R 32079331 3R 30649968..30650174 17..223 1035 100 Plus
3R 32079331 3R 30649430..30649522 265..357 195 80.6 Plus
Blast to na_te.dros performed on 2014-11-26 16:20:06 has no hits.

BO28962.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:13 Download gff for BO28962.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 8..647 17..658 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:58:14 Download gff for BO28962.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 8..647 17..658 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:39 Download gff for BO28962.complete
Subject Subject Range Query Range Percent Splice Strand
CG34433-RB 8..647 17..658 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:39 Download gff for BO28962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30650238..30650670 224..658 99   Plus
3R 30649968..30650174 17..223 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:58:14 Download gff for BO28962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26475960..26476392 224..658 99   Plus
arm_3R 26475690..26475896 17..223 100 -> Plus

BO28962.pep Sequence

Translation from 16 to 688

> BO28962.pep
MSGAESLFTWVYGPGVTRGGSVVGHHQPEALRPVLFLFYTLETIFNMFCM
GYHISGFQAIELHVFEWDTSVNICTGNTPAVVTEIWKSSAAAIVFILISL
STMWDAERQFYVFFFASELGDKNSHAFVEDRPIHPIFHYLRGMSISSLTC
GILYLLHATIMIDVKLTNDRNQGESKGTYMPIPLFVLGRFIHRKLSAYDW
FREFCENDIIYLASFLDHSWGPQR

BO28962.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34433-PB 212 CG34433-PB 1..212 1..212 1136 100 Plus
CG34433-PA 233 CG34433-PA 1..233 1..212 1104 91 Plus
CG34432-PA 213 CG34432-PA 16..211 27..210 499 51.5 Plus
CG14315-PA 217 CG14315-PA 8..214 31..209 295 29.4 Plus