Clone BO28963 Report

Search the DGRC for BO28963

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptnimA-RD
Protein status:BO28963.pep: Imported from assembly
Sequenced Size:1354

Clone Sequence Records

BO28963.complete Sequence

1354 bp assembled on 2011-08-24

GenBank Submission: KX796211

> BO28963.complete
GAAGTTATCAGTCGACATGATAAGAGAAAAGCTATTCGGAAAACTGCTCC
TCCTGCTTGCAATGGTTTTACCATTGGGATCAGGACAAAACAGCACCCTC
AAGATCAACACAAACGTGAAAGATATTGAAGCTGGGGTTGTGGCTCTGCC
CTCCATCCAGGGACCCGGGAACATCTGCATACGCGAGGAGCCATATGTGG
AGCACGTCCAGGTGCCAGAGATGCAGCCGGTGCGTGTGCGGACCTCCAGT
TGGTGCATGGAGATCCCGCCGAGATGCGCCACCTTCAAGACGGAAATGCG
CGAGGTGATGAGGGTCCAGAAATTGAACAAAACGCGAACAGTTCGCTTCT
GCTGTCAAGGATACGAGGGAAATTTGTCGGATAGTCAAGCCACATGCAAG
CCCATTTGCAGGGGCGGCTGTGGGCGTGGCAGTTGCGTAATGCCTGACAT
TTGCAGCTGCGAAGAGGGCTATATTGGCAAACATTGCACACAGCGCTGTG
ATCACGATCGCTGGGGACTGGACTGCAAGAATCTATGCCAATGTCAAAAT
GGAGCAGCCTGCGACAATAAATCGGGACTTTGTCACTGCATTGCCGGTTG
GACAGGACAATTTTGCGAGCTGCCCTGTCCACAGGGAACTTACGGCATCA
TGTGCCGCAAGGCTTGCGACTGCGATGAGAAGCCTTGCAATCCACAAACG
GGTGCTTGCATCCAGCAGGATCAACCTCTCCAACTGAATGTGAGCCACGT
CATCGTGGAGACTGTGAACTCCACGCTGGAGAAAATGGGTATTATACCGC
GTCCCACCACGCCCGTTCCCCTGCCGGAGGTCATAGTAATTAAGCAACCG
ACCAGCAATGAAAATGCCCAACACTCACCAAAGATCATTGTCCACCAATC
GAGCAGTGACCTACTCGAGAATCTCCATACGGCTGCAGCCGCCGGTGTTC
CCACTCCGGAGGTCATACACGTCATCACCAATGGGATCACCTCGCCACAG
GAGCATTTGGCCGGATTCGTTGGAGGTGAGGCCAATTCAAGTCAGACGGC
GACAGCTGATCATCAGTCCGGCTTGGTGGTCACACTGGTCAGCATAATGC
TCCTCCTGCTGGTCGCCATTGCGGTGGGTTCACTGTATGTGTACCGGAGG
TATCACCACAAAAATGCCGCAGTATACAATGCCAACGGAACGGTGACCAC
GCTGCCTGCAAATCCGGAAGTGGTTCTCACCGAAGCCGCGGTCCTGGGAA
AAAACTTCCACGAACCACTGCCTGAACCGCCCGTGGCCTTTGCGGTCACG
CCCCAATCAAACGAGGGTATCACAACCAGAGCTATAGCAAGCTTTCTAGA
CCAT

BO28963.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-RD 1323 CG42282-PD 1..1320 17..1336 6600 100 Plus
NimA-RE 1698 CG42282-PE 1..1316 17..1336 6505 99.7 Plus
NimA-RF 1698 CG42282-PF 1..1316 17..1336 6505 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-RD 2877 CG42282-RD 312..1631 17..1336 6600 100 Plus
NimA-RE 2873 CG42282-RE 312..1627 17..1336 6505 99.7 Plus
NimA-RF 2185 CG42282-RF 66..1381 17..1336 6505 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13961249..13961956 613..1320 3540 100 Plus
2L 23513712 2L 13957850..13958152 17..319 1515 100 Plus
2L 23513712 2L 13960828..13961006 317..495 895 100 Plus
2L 23513712 2L 13961064..13961181 495..612 590 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:20:58 has no hits.

BO28963.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:14 Download gff for BO28963.complete
Subject Subject Range Query Range Percent Splice Strand
nimA-RD 312..1631 17..1338 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:58:34 Download gff for BO28963.complete
Subject Subject Range Query Range Percent Splice Strand
NimA-RD 312..1631 17..1338 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:59 Download gff for BO28963.complete
Subject Subject Range Query Range Percent Splice Strand
NimA-RD 312..1631 17..1338 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:59 Download gff for BO28963.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13961249..13961956 613..1320 100 -> Plus
2L 13961064..13961181 495..612 100 -> Plus
2L 13960831..13961005 320..494 100 -> Plus
2L 13957850..13958152 17..319 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:58:34 Download gff for BO28963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13961249..13961956 613..1320 100 -> Plus
arm_2L 13961064..13961181 495..612 100 -> Plus
arm_2L 13960831..13961005 320..494 100 -> Plus
arm_2L 13957850..13958152 17..319 100 -> Plus

BO28963.pep Sequence

Translation from 16 to 1354

> BO28963.pep
MIREKLFGKLLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGP
GNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRV
QKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEE
GYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFC
ELPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQDQPLQLNVSHVIVETV
NSTLEKMGIIPRPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLL
ENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQ
SGLVVTLVSIMLLLLVAIAVGSLYVYRRYHHKNAAVYNANGTVTTLPANP
EVVLTEAAVLGKNFHEPLPEPPVAFAVTPQSNEGITTRAIASFLDH

BO28963.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-PD 440 CG42282-PD 1..440 1..440 2365 100 Plus
NimA-PE 565 CG42282-PE 1..433 1..433 2332 100 Plus
NimA-PF 565 CG42282-PF 1..433 1..433 2332 100 Plus
drpr-PD 613 CG2086-PD 20..224 44..244 388 36.7 Plus
drpr-PF 976 CG2086-PF 20..247 44..232 372 31.8 Plus
drpr-PD 613 CG2086-PD 254..327 146..219 181 36.5 Plus