Clone BO28965 Report

Search the DGRC for BO28965

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:65
Vector:pDNR-Dual
Associated Gene/Transcriptyellow-e2-RB
Protein status:BO28965.pep: Imported from assembly
Sequenced Size:1360

Clone Sequence Records

BO28965.complete Sequence

1360 bp assembled on 2011-08-24

> BO28965.complete
GAAGTTATCAGTCGACATGCTTATTCTAGCCCTTGTTGTGTGGCTCGCTT
ACCCAAATCTTTGCTTGGCCCAGTACCACCTTAATCCTCCCAAGACCATC
TTTCCGGACTTCAAGTTTCCCTCGGATTATAGGGATACACCCATAGTTTT
TGAATGGAAGAATCTGCAGTACGGCTTCCCCAGTGAACAGGAACGCGATC
AGGTGCTCCGGAATGGTCGCTATAATCCGGATAGTCCCATACCCATAGAC
ATCGATGTTTATTATCCACCTAATGGCGGTCCACCTAGACACTTTGTGAC
ATCGCCTCGCTTCGGACAGGGAGTTCCCTTTTCCCTGGGCTATGTGACCA
ATGTGCAGCGGGAGAACGGAAGTGAAATCCAGGCCTATCCTAGCTACCAG
TGGCACAGTAGCCACGGAGCGAATTGCGATGGTCTAACGTCCGTGTACCG
GGTTCATATCGATGCCTGTGGTCAGATGTGGGTGCTGGACAGCGGTGAAA
TTGAGTTCGTGCAGCACTGTGCCCCACAGGTTATGGTCTTCGACTTGGCC
ACCGATCAGTTGATCCATCGGTATCGTCTGCCCGAAACATCCTATAAGGC
GAAGGTCAGTAGATTTGTGAATATATTTGCAGACATCAGGGACCCACCGC
CAAGTGGGCAGTGCAAGGATGTATTTGCCTATCTGGCGGATCCCACAAGT
AAGGCCATAGTGGTGTACGATGTCGTGGGTCAGAGCTCCTGGCGCATCGA
GAACAAATTCACCTATCCGGATGCTAAGTTCGGAACGCACACAGTGGCTG
GTGAGAGTTTTGAGCTGCTCGATGGACCTTTGGCTTTGGCGACGACTCCT
TTGGGACTGGGATTGCGCCGCCATCTGATTTTCCACGCGCTGTCCAACGA
ACTGGAGCTGGCCATTCCTTTGGATATCCTAAATAATGCCACGAATTGGC
AAAAGGGTCTGAGCTCCTCCCTGTCGGAATTCACTGTCTTGGGTAAGAGA
GGGATTCAGTGTGCCTCGCATGCGATAAGCAGACAAGGATTCCTGTTCTG
TGGCTTCCTGGAGCCAATCGGAATTTTCGGCTGGGACATACGAAGGCCCT
ACAATCGCGAAAATGTCAAGCTACTTGCTATTAATCCGGCTACGCTGCAA
TTTGTGAGTGGCATGAAGATTGTCCGCAGACCTGCTGATGGACGGGAGGA
ACTGTGGCTGCTCTCCGATCGACTGCAGAAGATATTCGCCGGAACCATTG
ACTACAGGGAAATCAATTATCGGGTGATGCGGTGCGATGTTGATGACCTG
TTGCAGGGGCGGGGCTGCTTTGCAAGCTTTCTAGACCATTCGTTTGGCGC
GCAAAGCGGG

BO28965.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-RB 1308 CG17044-PB 1..1305 17..1321 6525 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-RB 1571 CG17044-RB 66..1370 17..1321 6525 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13405310..13406372 1321..259 5285 99.8 Minus
3R 32079331 3R 13406614..13406868 273..19 1260 99.6 Minus
Blast to na_te.dros performed 2014-11-26 16:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 2433..2501 866..797 140 68.6 Minus

BO28965.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:15 Download gff for BO28965.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 35..1339 17..1321 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:58:44 Download gff for BO28965.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 35..1339 17..1321 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:06 Download gff for BO28965.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 66..1370 17..1321 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:06 Download gff for BO28965.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13406618..13406870 17..269 99   Minus
3R 13405310..13406361 270..1321 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:58:44 Download gff for BO28965.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9232340..9232592 17..269 99   Minus
arm_3R 9231032..9232083 270..1321 100 <- Minus

BO28965.pep Sequence

Translation from 16 to 1360

> BO28965.pep
MLILALVVWLAYPNLCLAQYHLNPPKTIFPDFKFPSDYRDTPIVFEWKNL
QYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFG
QGVPFSLGYVTNVQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHIDA
CGQMWVLDSGEIEFVQHCAPQVMVFDLATDQLIHRYRLPETSYKAKVSRF
VNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRIENKFTY
PDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAI
PLDILNNATNWQKGLSSSLSEFTVLGKRGIQCASHAISRQGFLFCGFLEP
IGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPADGREELWLLS
DRLQKIFAGTIDYREINYRVMRCDVDDLLQGRGCFASFLDHSFGAQSG

BO28965.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-PB 435 CG17044-PB 1..435 1..435 2342 100 Plus
yellow-d2-PA 412 CG9891-PA 25..411 44..434 1123 53.3 Plus
yellow-d-PA 432 CG9889-PA 1..416 1..431 871 40.3 Plus
yellow-e3-PA 409 CG17045-PA 27..397 46..434 552 32.1 Plus
yellow-h-PA 463 CG1629-PA 55..440 43..434 513 30.9 Plus