Clone BO28966 Report

Search the DGRC for BO28966

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG14762-RB
Protein status:BO28966.pep: Imported from assembly
Sequenced Size:1528

Clone Sequence Records

BO28966.complete Sequence

1528 bp assembled on 2011-08-24

GenBank Submission: KX795145

> BO28966.complete
GAAGTTATCAGTCGACATGGCGGGAATTCAGCTGCAATCGGGATGCACGA
TGGTCGTGACGGTGGTGCTCCTGCTGCAGGTGCTTGTGATGGACCAGGTG
CTCGGCCAGGGTCCACCGCAGACTCAAGTGTGTCCGGAGCAGAGCGAGAT
CGCGCCCTGCATCTGCACGGTGAAGAAGAACGGGCTGGACATCCTGTGCG
AGACCACCGATCTGGCGCACATCACCAAGTCGATGGGCACGCTGAAGGGC
AAGAGTCCCATCATCTTCTACCTGAAGCTTCGCCACAACAATCTGCCCAA
GCTGCAGGGCTTCGTCTTCCTGGCCCTTGACATCCGTCACCTGACCATCC
ACAACAGCAGCCTGGCGGCCATCGAGGAGAACGCCCTCAGCTCGCTGGGA
GCGGGACTGACGCAGCTGGATGTGTCCCTCAACCAAATGAAGACGGTGCC
CTCGCAGGCTCTGCAACATCTGTTCCACCTGTTGATCCTTAATCTGAACC
ACAATAAAATCACCGTGATCCACAACAATGCCTTCGAGGGACTGGAGACC
CTGGAGATTCTGACGCTCTACGAGAACAAGATTACACAGATCGATCCCGA
GGCTTTCCGAGGACTTGAGGACCATATTAAGCGCCTGAATTTGGGTGGCA
ACGATCTTACCAATATCCCGCAGAAAGCTCTTTCCATTTTGAGCACCTTA
AAGAAACTGGAGATTCAGGAGAACAAGATACGAACTATCAGCGAAGGCGA
TTTCGAAGGCTTGCAGAGCCTGGACTCATTGATTTTGGCCCACAACATGA
TCACCACCGTGCCTGCCAATGTGTTTAGTCACCTCACCCTGCTAAACTCC
TTGGAGCTGGAGGGCAATAAGATCAGTGTGATTGACAAGGATGCCTTCAA
GGGCCTAGAGGAGAACCTGCAATATCTGCGCCTGGGTGATAACCAGATCC
ACACTATTCCCAGCGAGGCACTGCGTCCGCTGCACCGCCTTCGCCACTTG
GACTTGCGCAACAACAATATCAATGTTTTGGCTGAAGATGCCTTCACTGG
CTTTGGAGATTCCCTGACTTTCCTCAACCTGCAGAAGAACGACATCAAGG
TTCTGCCCAGTCTTCTGTTTGAGAACCTCAACTCGCTGGAAACGCTGAAC
CTGCAGAACAACAAGTTGCAGCGCATTCCGCAGGACATAATGGAGCCCGT
CATCGACACCCTTCGCATCATCGATATCACCGATAACCCGCTGAACTGCT
CCTGCGAGCTGACCTGGTTCCCCAAGCTGCTGGAGGACCTGAAGAACAAG
GACGACGAAATGTCGCAGAAGAAGAAGCCGCTGTGCCACATGTCGCTGGA
CAACCGCGAGTACTTCGTGCAGGCCATGCCCACCGAGAAGATGCACTGCG
CCGGCCTCAATGTGAGTCCCTCGCCGACCAGCGGCGGTCTAATGCGGATC
CTGCAAGTGAACATCCTGGCCCAGATTGCCGTGTGTAGCGTGGCCTTTTT
AACTAGCGTCGCAAGCTTTCTAGACCAT

BO28966.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-RB 1497 CG14762-PB 1..1494 17..1510 7470 100 Plus
CG14762-RA 1413 CG14762-PA 1..1395 17..1411 6975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-RB 3801 CG14762-RB 836..2330 16..1510 7475 100 Plus
CG14762-RA 3658 CG14762-RA 836..2231 16..1411 6980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8012346..8012729 399..16 1920 100 Minus
2R 25286936 2R 8010815..8011093 1510..1232 1395 100 Minus
2R 25286936 2R 8012060..8012283 621..398 1120 100 Minus
2R 25286936 2R 8011401..8011582 1092..911 910 100 Minus
2R 25286936 2R 8011643..8011797 911..757 775 100 Minus
2R 25286936 2R 8011172..8011311 1232..1093 700 100 Minus
2R 25286936 2R 8011865..8012002 759..622 690 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:21:55 has no hits.

BO28966.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:15 Download gff for BO28966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 836..2329 17..1512 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:01 Download gff for BO28966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 837..2330 17..1512 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:19 Download gff for BO28966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 837..2330 17..1512 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:19 Download gff for BO28966.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8012347..8012728 17..398 100   Minus
2R 8012060..8012282 399..621 100 <- Minus
2R 8011866..8012002 622..758 100 <- Minus
2R 8011643..8011795 759..911 100 <- Minus
2R 8011401..8011581 912..1092 100 <- Minus
2R 8011172..8011311 1093..1232 100 <- Minus
2R 8010813..8011092 1233..1512 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:01 Download gff for BO28966.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3899852..3900233 17..398 100   Minus
arm_2R 3899565..3899787 399..621 100 <- Minus
arm_2R 3899371..3899507 622..758 100 <- Minus
arm_2R 3899148..3899300 759..911 100 <- Minus
arm_2R 3898906..3899086 912..1092 100 <- Minus
arm_2R 3898677..3898816 1093..1232 100 <- Minus
arm_2R 3898318..3898597 1233..1512 99 <- Minus

BO28966.pep Sequence

Translation from 16 to 1528

> BO28966.pep
MAGIQLQSGCTMVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCIC
TVKKNGLDILCETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFV
FLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQ
HLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGL
EDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQ
SLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEEN
LQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSL
TFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLR
IIDITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYF
VQAMPTEKMHCAGLNVSPSPTSGGLMRILQVNILAQIAVCSVAFLTSVAS
FLDH

BO28966.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-PB 498 CG14762-PB 1..498 1..498 2537 100 Plus
CG14762-PA 470 CG14762-PA 1..470 1..470 2387 99.1 Plus
caps-PB 540 CG11282-PB 74..410 106..422 388 32.1 Plus
caps-PA 540 CG11282-PA 74..410 106..422 388 32.1 Plus
caps-PD 780 CG11282-PD 74..410 106..422 388 32.1 Plus
caps-PB 540 CG11282-PB 172..414 86..333 179 27.9 Plus
caps-PA 540 CG11282-PA 172..414 86..333 179 27.9 Plus