Clone BO28973 Report

Search the DGRC for BO28973

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG7777-RC
Protein status:BO28973.pep: Imported from assembly
Sequenced Size:844

Clone Sequence Records

BO28973.complete Sequence

844 bp assembled on 2011-08-24

GenBank Submission: KX797213

> BO28973.complete
GAAGTTATCAGTCGACATGGGAAAATTCGAATACTCACTGGGTCTCAATG
AGCTCAAATCCAAGGAGCTGCGATTGTGGCAGGCCTTGATTGGAGAATTC
CTTGGCAATTTGATCCTCAATTTCTTTGCCTGCGGCGCATGCACCCAAAT
TGAGGATGGCACCTTCAAGGCCTTGGCTTTTGGCCTGGCTATCTTCATGG
CCATCACGATTGTGGGCCACTTGAGTGGTGGTCATGTGAATCCTGCCGTT
ACCGCTGGAATGTTGGTCGCAGGACGAATTAGCTTGATCAGAGCCTTTTT
CTATGTGGTTTTCCAGTGCTTGGGTGCAATTGCCGGAACTGCAGCGGTTA
AGATTCTCATCGATCAGGACTATTACAATGGCCTGGGTCACACCTCTCTG
GCGCCCAATATCACCGAGCTGCAGGGCCTGGGAATCGAGTTCTTCCTGGG
ACTCCTGCTGGTGCTCGTCGTCTTTGGGGCCTGTGATCCCCACAAGCCCG
ATTCCCGCTACACGGCGCCCTTGGCCATCGGAATGGCGGTGACCCTGGGT
CACTTGGGCACCATCCGCTACACCGGGGCCAGCATGAATCCCGCTCGCAC
CGTGGGCACCGCCTTTGCCACCGACATCTGGGCGTCGCATTGGGTATACT
GGGTGGGACCTGTGCTGGGGGGCGTGGCTGCCGCCCTGCTCTACACCCAG
GTCCTGGAGGCGAAGCCCGTGCCAAAGGTTAACGAGGCATCCGAGAAGTA
CCGAACGCACGCCGATGAACGCGAGGGATGCAAACCGAACCACAACCCGA
ACCATTTGGCATATACATATCTCGCTGCAAGCTTTCTAGACCAT

BO28973.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-RC 813 CG7777-PC 1..810 17..826 4050 100 Plus
CG7777-RB 807 CG7777-PB 1..760 17..776 3800 100 Plus
CG7777-RD 780 CG7777-PD 1..759 17..775 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-RC 1479 CG7777-RC 216..1025 17..826 4050 100 Plus
CG7777-RB 1386 CG7777-RB 216..975 17..776 3800 100 Plus
CG7777-RD 1388 CG7777-RD 216..974 17..775 3795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11441066..11441491 351..776 2130 100 Plus
2R 25286936 2R 11439968..11440125 51..208 790 100 Plus
2R 25286936 2R 11440186..11440330 208..352 725 100 Plus
2R 25286936 2R 11441648..11441700 774..826 265 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:23:13 has no hits.

BO28973.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:18 Download gff for BO28973.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 213..1022 17..828 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:59:41 Download gff for BO28973.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 216..1025 17..828 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:17:50 Download gff for BO28973.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 216..1025 17..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:17:50 Download gff for BO28973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11441650..11441700 776..828 96   Plus
2R 11441068..11441490 353..775 100 -> Plus
2R 11440187..11440330 209..352 100 -> Plus
2R 11439970..11440125 53..208 100 -> Plus
2R 11439833..11439868 17..52 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:59:41 Download gff for BO28973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7329155..7329205 776..828 96   Plus
arm_2R 7328573..7328995 353..775 100 -> Plus
arm_2R 7327692..7327835 209..352 100 -> Plus
arm_2R 7327475..7327630 53..208 100 -> Plus
arm_2R 7327338..7327373 17..52 100 -> Plus

BO28973.pep Sequence

Translation from 16 to 844

> BO28973.pep
MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTF
KALAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQ
CLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFFLGLLLVL
VVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF
ATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD
EREGCKPNHNPNHLAYTYLAASFLDH

BO28973.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-PC 270 CG7777-PC 1..270 1..270 1415 100 Plus
CG7777-PD 259 CG7777-PD 1..253 1..253 1312 100 Plus
CG7777-PA 264 CG7777-PA 1..253 1..253 1312 100 Plus
CG7777-PB 268 CG7777-PB 1..253 1..253 1312 100 Plus
Drip-PE 239 CG9023-PE 1..228 1..233 473 40.4 Plus