Clone BO28975 Report

Search the DGRC for BO28975

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:75
Vector:pDNR-Dual
Associated Gene/Transcriptsm-RJ
Protein status:BO28975.pep: Imported from assembly
Sequenced Size:1426

Clone Sequence Records

BO28975.complete Sequence

1426 bp assembled on 2011-08-24

GenBank Submission: KX798265

> BO28975.complete
GAAGTTATCAGTCGACATGAATAACCTGAACGCGAATGCCAGTGCCTTTT
TGTGGCAGGTACCGCCGCCGCAGCAGTTGACCCCTCAATCGGTGCAGCAG
CAGACGGTGCAGTCGGTGCAGTCCATGCAGTCCGTGCAGCATAGCCAGCT
GCTTCAATCCGCTGTAGTCTCGCAGCCGCGCAAGTTTGGTGGCAACAAGA
GCAACTATAACTACATGCAGAATCATGCCATTATGGGTCCGGGCGGCGGT
CCAATGGGTGGGATCGGTGGCAACCCTAACATCTACCGAAAGCGCCATTC
TATCAACACCTACAATGCTGGCTTATATCAAACCAATGTAGCAACACTGT
CGACACCACAACAACATGTTTCCCATCAACACCACCACCACCTCCGCCAA
CAACAACAACAACAACATCAACAACAAGCACCACAACAACAACCACATCC
ACAACACCTTCACCACCAACAACAACTAGTTGCCCCAGCTCAATCGCACA
ATCTTTATCAATTTAAAGAACCACCGCTATTGGGACCCGGAGCCGCTTTC
CCACCATTCGGAGCTCCCGAATATCACACCACCACACCGGAGAACTGGAA
GGGGGCCGCCATCCATCCCACTGGCCTGATGAAGGAGCCCGCTGGTGTTG
TGCCCGGACGCAATGCTCCGGTGGCCTTCACACCGCAAGGACAGGCTCAG
GGCGCCGTCATGATGGTCTACGGCCTGGACCACGACACTTCCAACACGGA
TAAGCTCTTCAATTTGGTTTGCCTGTACGGCAACGTGGCACGGATCAAGT
TCTTGAAGACCAAAGAGGGCACCGCCATGGTGCAAATGGGAGACGCTGTG
GCCGTTGAGCGTTGCGTGCAGCACTTGAACAACATTCCCGTGGGCACTGG
TGGCAAGATACAGATCGCTTTCTCCAAACAGAACTTCCTATCCGAGGTGA
TCAACCCGTTCTTGCTGCCCGATCATTCGCCCAGCTTCAAGGAGTACACC
GGCTCCAAGAACAATCGTTTCCTATCGCCGGCCCAGGCGAGCAAGAATCG
CATTCAACCACCGAGCAAGATTTTGCACTTTTTCAACACACCGCCCGGCT
TGACCGAGGACCAACTGATTGGAATCTTTAACATCAAGGATGTGCCCGCC
ACATCGGTGCGCCTGTTCCCCTTGAAGACCGAGCGCTCGTCGTCGGGACT
GATCGAATTTTCCAATATCTCGCAGGCAGTGCTGGCTATCATGAAGTGCA
ACCATCTGCCTATTGAGGGTAAAGGCACCAAGTTCCCATTCATCATGAAG
CTGTGCTTTTCCTCATCCAAGAGCATGAACGGCGCCTGGAACAATGCGGC
CAGCGAGGGCATGATCGAGAAGGAGAACGAGGTGGATACCAAGGTGGACA
TCTACAATGCAAGCTTTCTAGACCAT

BO28975.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
sm-RJ 1395 CG9218-PJ 1..1392 17..1408 6960 100 Plus
sm-RT 1659 CG9218-PT 586..1656 338..1408 5355 100 Plus
sm-RK 1608 CG9218-PK 535..1605 338..1408 5355 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
sm-RJ 2379 CG9218-RJ 301..1693 16..1408 6965 100 Plus
sm-RT 3226 CG9218-RT 1498..2568 338..1408 5355 100 Plus
sm-RK 3175 CG9218-RK 1447..2517 338..1408 5355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19538029..19538392 701..338 1820 100 Minus
2R 25286936 2R 19546449..19546771 338..16 1615 100 Minus
2R 25286936 2R 19532436..19532712 1069..793 1385 100 Minus
2R 25286936 2R 19532169..19532376 1275..1068 1040 100 Minus
2R 25286936 2R 19530567..19530702 1408..1273 680 100 Minus
2R 25286936 2R 19537776..19537872 793..697 485 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:24:24 has no hits.

BO28975.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:20 Download gff for BO28975.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 285..1676 17..1410 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:11 Download gff for BO28975.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 302..1693 17..1410 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:18:20 Download gff for BO28975.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 302..1693 17..1410 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:18:20 Download gff for BO28975.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19546449..19546770 17..338 100   Minus
2R 19538030..19538391 339..700 100 <- Minus
2R 19537776..19537868 701..793 100 <- Minus
2R 19532436..19532711 794..1069 100 <- Minus
2R 19532170..19532374 1070..1274 100 <- Minus
2R 19530564..19530700 1275..1410 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:11 Download gff for BO28975.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15433954..15434275 17..338 100   Minus
arm_2R 15425535..15425896 339..700 100 <- Minus
arm_2R 15425281..15425373 701..793 100 <- Minus
arm_2R 15419941..15420216 794..1069 100 <- Minus
arm_2R 15419675..15419879 1070..1274 100 <- Minus
arm_2R 15418069..15418205 1275..1410 98 <- Minus

BO28975.pep Sequence

Translation from 16 to 1426

> BO28975.pep
MNNLNANASAFLWQVPPPQQLTPQSVQQQTVQSVQSMQSVQHSQLLQSAV
VSQPRKFGGNKSNYNYMQNHAIMGPGGGPMGGIGGNPNIYRKRHSINTYN
AGLYQTNVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHH
QQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIH
PTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNL
VCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQI
AFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPS
KILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSN
ISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMI
EKENEVDTKVDIYNASFLDH

BO28975.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
sm-PJ 464 CG9218-PJ 1..464 1..464 2469 100 Plus
sm-PI 420 CG9218-PI 1..420 1..464 2075 87.5 Plus
sm-PK 535 CG9218-PK 177..535 106..464 1901 99.4 Plus
sm-PT 552 CG9218-PT 196..552 108..464 1900 100 Plus
sm-PV 540 CG9218-PV 184..540 108..464 1899 99.7 Plus