Clone BO28980 Report

Search the DGRC for BO28980

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptCG11600-RB
Protein status:BO28980.pep: Imported from assembly
Sequenced Size:1252

Clone Sequence Records

BO28980.complete Sequence

1252 bp assembled on 2011-08-24

GenBank Submission: KX794084

> BO28980.complete
GAAGTTATCAGTCGACATGTTGTTGATGGAGCTCGTGATTTTCTTTGACT
GGCTGTTGATCGTCTCTGGTATGCCGAAGGTGAAGTTTGGCCTCCAAAAT
TTTACGGGTCGTGGTAAAGATTACCGCATCAAAGTGATTACTGGGATTCT
TATAATAGACAAGTACGGCTACTCAGTGGAGACGCACACGGTTCGCACTG
GAGATGGATACATTCTGGATATGTTTCGGATTCCCTCATCACCCAACTGC
AAGGAGGACGGTTTCAAGCCGTCTGTTCTTATCCAGCACGGACTGATCAG
CCTGGCCGATTCCTTCCTGGTGACGGGACCGAGGAGCGGACTTCCATTCA
TGCTGGCCGATCGCTGCTACGACGTGTGGCTGAGCAACAGCCGGGGAGTC
CGCTACTCGCAGCGCCACATCCGGCTGAAGGCTTCCCAGGATGCCTTCTG
GCGCTTTAGCTGGCACGAAATGGGAATGGAGGACCTGCCCGCCATGATCG
ACTACATCCTGTCCACGACAAACGAGGAAGCGTTGCACTTCGTTTGCCAT
TCTCAGGGATGCACCACCCTACTGGTTTTGCTCAGCATGAAGCCGGAGTA
TAACCGGATGATAAAGACGGCCAACATGATGGCCCCCGCCGTTTTCATGA
AGCACGCAAGGAACAAGCTAATGAAAATGTTTGGGAACATCATTATGAGC
ATGAAGGACAGTAGTTTTTTTGGCCCCTTAGATGCTATAAGATTCCTGCT
ATCCGTTTTTTGCAAATGCTCGAAGTTTAAAAAATTGTGCGCCTTTATGT
TCATATTGGCCAGTGAAGAACCAACATCGTATATGAACAATACCGCCATA
CCATTGATATTAGCAACGCATCCTGGTGCGATTTCCACTCGACAGCCAAA
GCACTTTCTTCAACTCCGGAAATCTGGAAAATTCCGTCCGTATGACTTCG
GAGTCATGAGAAATAAAAAACTATACAATCAGGACACGCCTCCCGATTAT
CCGTTGGAAAACGTCCGCCCTCAGTCGCCCATTCATATATACCACAGCCA
TGGTGACGACTTGGTGGCGCGCAAAGACATCCACATACTGATCAGCAAGT
TGGACAAGGCGGTGTTGCATGACGTTGTTTTTGAAAAATGGAGCCACTCG
GACTTTCTGTTCGCCAAATTAATCAAAAAAGTTGTTAATGAACCAATTAT
CAAAGTTATTGATCACTTTGAGAATAGACAGCAAGCAAGCTTTCTAGACC
AT

BO28980.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-RB 1221 CG11600-PB 1..1218 17..1234 6090 100 Plus
CG11598-RB 1167 CG11598-PB 361..522 443..604 285 78.4 Plus
CG18530-RA 1167 CG18530-PA 360..520 445..605 265 77.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-RB 1330 CG11600-RB 14..1231 17..1234 6090 100 Plus
CG11598-RB 1248 CG11598-RB 361..522 443..604 285 78.4 Plus
CG18530-RA 1188 CG18530-RA 363..523 445..605 265 77.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12636735..12637431 145..841 3485 100 Plus
3R 32079331 3R 12637485..12637877 842..1234 1965 100 Plus
3R 32079331 3R 12636553..12636681 17..145 645 100 Plus
3R 32079331 3R 12635332..12635493 443..604 285 78.4 Plus
3R 32079331 3R 12633781..12633941 445..605 265 77.6 Plus
3R 32079331 3R 12639039..12639190 449..600 220 76.3 Plus
Blast to na_te.dros performed on 2014-11-26 16:25:23 has no hits.

BO28980.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:22 Download gff for BO28980.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 6..1218 22..1236 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:35 Download gff for BO28980.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 19..1231 22..1236 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:18:45 Download gff for BO28980.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 19..1231 22..1236 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:18:45 Download gff for BO28980.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12637485..12637877 842..1236 99   Plus
3R 12636736..12637431 146..841 100 -> Plus
3R 12636558..12636681 22..145 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:35 Download gff for BO28980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8463207..8463599 842..1236 99   Plus
arm_3R 8462458..8463153 146..841 100 -> Plus
arm_3R 8462280..8462403 22..145 100 -> Plus

BO28980.pep Sequence

Translation from 16 to 1252

> BO28980.pep
MLLMELVIFFDWLLIVSGMPKVKFGLQNFTGRGKDYRIKVITGILIIDKY
GYSVETHTVRTGDGYILDMFRIPSSPNCKEDGFKPSVLIQHGLISLADSF
LVTGPRSGLPFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWH
EMGMEDLPAMIDYILSTTNEEALHFVCHSQGCTTLLVLLSMKPEYNRMIK
TANMMAPAVFMKHARNKLMKMFGNIIMSMKDSSFFGPLDAIRFLLSVFCK
CSKFKKLCAFMFILASEEPTSYMNNTAIPLILATHPGAISTRQPKHFLQL
RKSGKFRPYDFGVMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGDDLV
ARKDIHILISKLDKAVLHDVVFEKWSHSDFLFAKLIKKVVNEPIIKVIDH
FENRQQASFLDH

BO28980.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-PB 406 CG11600-PB 1..406 1..406 2147 100 Plus
CG11608-PB 430 CG11608-PB 8..407 1..402 1023 48.5 Plus
CG11598-PB 388 CG11598-PB 24..388 46..410 987 49 Plus
CG18530-PA 389 CG18530-PA 19..380 41..402 977 49.4 Plus
mag-PA 399 CG5932-PA 36..399 47..404 681 38.3 Plus