Clone BO28989 Report

Search the DGRC for BO28989

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG42554-RA
Protein status:BO28989.pep: Imported from assembly
Sequenced Size:673

Clone Sequence Records

BO28989.complete Sequence

673 bp assembled on 2011-08-24

GenBank Submission: KX796221

> BO28989.complete
GAAGTTATCAGTCGACATGGACTGCGCACCACTGAACTTGGCTCATTTCC
ACGAGCGAAGGTCGGAGCGATTTATACGCAATCACCGCTATGAGGAGGCC
ATTAAAGCGCTGGAAACATCCCTAATCTACATGCAGGATGCCCAAAAACG
GGTGGCTCTGCCCAAATCCAAGGAAGTTCTGGACACATTGACCCTCGATT
TTCAGCGCAAACTGCGTCAAATTGAGATGCGAAAGACGCAGCATGGTCTG
AACAAGCTGAAGGATTATGCTCCCTTGAAGGAAACCAGTCCCATGCTGCC
CCTGCGACCAGAAGCCGGAGCAAGTGGAGGCGCAGGAGGATCCGCTCAGT
CGGTGGCCAAGGCAATCGACAAAACAGTGCAGGACTTCGATGCCAAGTTC
ACCTCCTCCTTGGTGGCAAAGGCCTCTAGCACACTGGCCCATTCGGAGCC
CCATATGGAGACGCTGAAGAAGAGCGATTCTGCCCAGGAGGAGCAGGAAC
ACGATACTTGCGATCAGCGGCTGGCGGGCAGTGGAGACCTGGACCTGCCA
TCCTTGGCGCCCTTGGAGTTGCCCTCCTTCGATTACAGCCTGTTCACCAG
CTCCTCGGCTCCTTCGTTGGCCAGCTATGCCGGCATGGCTGAGAGCTTCC
AGAAAGCAAGCTTTCTAGACCAT

BO28989.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-RA 642 CG42554-PA 1..639 17..655 3195 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-RA 1023 CG42554-RA 163..803 15..655 3205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 835935..836550 40..655 3080 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:27:37 has no hits.

BO28989.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:26 Download gff for BO28989.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 41..679 17..657 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:01:26 Download gff for BO28989.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 165..803 17..657 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:38 Download gff for BO28989.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 165..803 17..657 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:19:38 Download gff for BO28989.complete
Subject Subject Range Query Range Percent Splice Strand
3L 835936..836550 41..657 99   Plus
3L 835847..835870 17..40 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:26 Download gff for BO28989.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 835936..836550 41..657 99   Plus
arm_3L 835847..835870 17..40 100 -> Plus

BO28989.pep Sequence

Translation from 16 to 673

> BO28989.pep
MDCAPLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPK
SKEVLDTLTLDFQRKLRQIEMRKTQHGLNKLKDYAPLKETSPMLPLRPEA
GASGGAGGSAQSVAKAIDKTVQDFDAKFTSSLVAKASSTLAHSEPHMETL
KKSDSAQEEQEHDTCDQRLAGSGDLDLPSLAPLELPSFDYSLFTSSSAPS
LASYAGMAESFQKASFLDH

BO28989.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-PA 213 CG42554-PA 1..213 1..213 1077 100 Plus