Clone BO28991 Report

Search the DGRC for BO28991

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG42661-RA
Protein status:BO28991.pep: Imported from assembly
Sequenced Size:477

Clone Sequence Records

BO28991.complete Sequence

477 bp assembled on 2011-08-24

> BO28991.complete
GAAGTTATCAGTCGACATGTGCTTTTGTCCGACACTTGGTCTCAAAATTG
TACTTTTGTTAGTAATACCTATAACCGCAGGAATTAATGGTGCTCAAATA
GCCAAAGATGTTTCTATATTGAATTTATTAAAGGGATACCATTATATTAT
GCTTATTATAAGCCTATCCCTGTCCGTAGTTATACTGGCGACTCTGGTTC
TTTTAATATATGCGGCGATCTGTAATAAAATTCGAATTCTGAAAGTGATG
ATCTTTGTTTATGTAGCCATCGTCGTGGTGAAACTGATAATTCTGTTCGT
GTGTCTAAGTACTGAATTGAATCCTGACAAGACGACAGCCCATCCCATAT
TTATGATATGCTGGCTCCTTACGTTCTTATGTATGGCCGTTATAATAATA
TACTGGCTTCGGCTACATGACCTTGCCAACGAAGACAATGCAAGCTTTCT
AGACCATTCGTTTGGCGCGCAAAGAGG

BO28991.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 426 CG42661-PB 1..423 17..439 2115 100 Plus
CG42661-RA 426 CG42661-PA 1..423 17..439 2115 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 2597 CG42661-RB 536..958 17..439 2115 100 Plus
CG42661-RA 2531 CG42661-RA 536..958 17..439 2115 100 Plus
CG42660-RB 2597 CG42660-RB 536..958 17..439 2115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7466401..7466568 80..247 840 100 Plus
3L 28110227 3L 7466625..7466751 247..373 635 100 Plus
3L 28110227 3L 7466818..7466884 373..439 335 100 Plus
3L 28110227 3L 7466286..7466349 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:27:56 has no hits.

BO28991.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:27 Download gff for BO28991.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 536..958 17..439 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:01:36 Download gff for BO28991.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RA 536..958 17..439 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:46 Download gff for BO28991.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 536..958 17..439 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:19:46 Download gff for BO28991.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7466819..7466884 374..439 100   Plus
3L 7466626..7466751 248..373 100 -> Plus
3L 7466401..7466568 80..247 100 -> Plus
3L 7466286..7466348 17..79 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:36 Download gff for BO28991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7459919..7459984 374..439 100   Plus
arm_3L 7459726..7459851 248..373 100 -> Plus
arm_3L 7459501..7459668 80..247 100 -> Plus
arm_3L 7459386..7459448 17..79 100 -> Plus

BO28991.pep Sequence

Translation from 16 to 475

> BO28991.pep
MCFCPTLGLKIVLLLVIPITAGINGAQIAKDVSILNLLKGYHYIMLIISL
SLSVVILATLVLLIYAAICNKIRILKVMIFVYVAIVVVKLIILFVCLSTE
LNPDKTTAHPIFMICWLLTFLCMAVIIIYWLRLHDLANEDNASFLDHSFG
AQR

BO28991.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-PB 141 CG42661-PB 1..141 1..141 709 100 Plus
CG42661-PA 141 CG42661-PA 1..141 1..141 709 100 Plus
CG42660-PB 142 CG42660-PB 1..134 1..133 283 45.5 Plus
CG42660-PA 142 CG42660-PA 1..134 1..133 283 45.5 Plus
CG43292-PA 142 CG43292-PA 1..133 1..135 147 28.1 Plus