Clone BO28994 Report

Search the DGRC for BO28994

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG43057-RA
Protein status:BO28994.pep: Imported from assembly
Sequenced Size:403

Clone Sequence Records

BO28994.complete Sequence

403 bp assembled on 2011-08-24

GenBank Submission: KX796450

> BO28994.complete
GAAGTTATCAGTCGACATGAAGCTACTGCTGTTGGCGGTGATTGTTGCCC
TCGCTTGGCTTCTTATAGAGGCTGGCAAGACCAGGACTAAGAACAGCTCC
TGTCTGGTGAAAAACAAATATCCCCCCGAATCTTCTTGTAGATCATCGCA
TCGGGAATTCTTTGCCTTTCACCGAGTTCTATTCGACTGCATAAAGGTGA
CCACAAATTGCCGCAAGATCTACAGGAGGAATGAGTTCCATAGTTTGCAA
TCGTGCAGAGATGCATGTCACTACCACATGGCTGAACCAAGTCCGCCACC
ACCCCAAAATGGTACGACTTCTGCACCTGGAGGTGCCTCCGGAGCGCCAG
GAGACGCTCCAGCAGCTGAAACGCCAGCTGCAGCGGCAAGCTTTCTAGAC
CAT

BO28994.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43057-RB 372 CG43057-PB 1..369 17..385 1845 100 Plus
CG43057-RA 372 CG43057-PA 1..369 17..385 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43057-RB 577 CG43057-RB 15..384 16..385 1850 100 Plus
CG43057-RA 468 CG43057-RA 15..384 16..385 1850 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8243516..8243707 385..194 960 100 Minus
2L 23513712 2L 8243757..8243868 198..87 560 100 Minus
2L 23513712 2L 8243913..8243989 92..16 370 98.7 Minus
Blast to na_te.dros performed on 2014-11-26 16:25:55 has no hits.

BO28994.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:22 Download gff for BO28994.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 1..369 17..387 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:46 Download gff for BO28994.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 16..384 17..387 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:18:56 Download gff for BO28994.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 16..384 17..387 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:18:56 Download gff for BO28994.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8243919..8243988 17..86 100   Minus
2L 8243759..8243868 87..196 100 <- Minus
2L 8243513..8243704 197..387 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:46 Download gff for BO28994.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8243919..8243988 17..86 100   Minus
arm_2L 8243759..8243868 87..196 100 <- Minus
arm_2L 8243513..8243704 197..387 98 <- Minus

BO28994.pep Sequence

Translation from 16 to 403

> BO28994.pep
MKLLLLAVIVALAWLLIEAGKTRTKNSSCLVKNKYPPESSCRSSHREFFA
FHRVLFDCIKVTTNCRKIYRRNEFHSLQSCRDACHYHMAEPSPPPPQNGT
TSAPGGASGAPGDAPAAETPAAAASFLDH

BO28994.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG43057-PB 123 CG43057-PB 1..123 1..123 661 100 Plus
CG43057-PA 123 CG43057-PA 1..123 1..123 661 100 Plus