Clone BO28996 Report

Search the DGRC for BO28996

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:289
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCG18537-RA
Protein status:BO28996.pep: Imported from assembly
Sequenced Size:598

Clone Sequence Records

BO28996.complete Sequence

598 bp assembled on 2011-08-24

GenBank Submission: KX795382

> BO28996.complete
GAAGTTATCAGTCGACATGGATTCCGGCTATTCGTCAGTCTTAATATTGT
TGGCAGTTTGGCTAATCAGTAGATGCGGAGCAGCGCGGAAATGGGAGTAC
GAACCTGTATTGATATTAACCACCTCTTCGGACGACAGTCTAATAAAATT
AGAGTCCAGTATTGTTCGCTTAGGGCGTGGAAAGTTTGGAATATCAGCGC
GGGTGGAGTGGAACTATGACACCACTGAGGAGACAATGGTGGAGGCTGTT
GTATACCGCAGCAATTCGGGTGATGAGTCCGACTACAAGCTGCTCCCTTG
GGCCATTCCTAAGCAAACCTTTTACGACTACCTCAACTCCTACTACAAGG
ATGTGATAATGAAGAACTTTGCCCCCTGTTCCAATGTGCCGCAGTTCAAG
GGCAAATTTCAACCGCCTTGGCCGAAACGAACGTATATCGGTGACAAATG
CGTCTTTGAAGCCGAAGGTTTTCCGGATATCGTGCCACCTGGATTCTACA
AGATTATTTTCAATTGTACCGGACCTGATCAGCCATCGTGGAGCTTTATC
GGAATTTTTAAAATAATAAACAAAATGTTTGCAAGCTTTCTAGACCAT

BO28996.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG18537-RA 567 CG18537-PA 1..564 17..580 2820 100 Plus
CG18538-RA 549 CG18538-PA 246..419 280..453 315 78.7 Plus
CG18536-RA 576 CG18536-PA 199..350 206..357 265 78.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG18537-RA 607 CG18537-RA 18..581 17..580 2820 100 Plus
CG18538-RA 549 CG18538-RA 246..419 280..453 315 78.7 Plus
CG18536-RA 788 CG18536-RA 351..502 206..357 265 78.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18296288..18296630 238..580 1715 100 Plus
2R 25286936 2R 18296072..18296229 85..242 790 100 Plus
2R 25286936 2R 18295945..18296013 17..85 345 100 Plus
2R 25286936 2R 18297448..18297621 280..453 315 78.7 Plus
2R 25286936 2R 18295272..18295372 257..357 205 80.2 Plus
Blast to na_te.dros performed on 2014-11-26 16:26:27 has no hits.

BO28996.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:23 Download gff for BO28996.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..564 17..582 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:59 Download gff for BO28996.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 18..581 17..582 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:10 Download gff for BO28996.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 18..581 17..582 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:19:10 Download gff for BO28996.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18296289..18296630 239..582 99   Plus
2R 18296073..18296225 86..238 100 -> Plus
2R 18295945..18296013 17..85 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:59 Download gff for BO28996.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14183794..14184135 239..582 99   Plus
arm_2R 14183578..14183730 86..238 100 -> Plus
arm_2R 14183450..14183518 17..85 100 -> Plus

BO28996.pep Sequence

Translation from 16 to 598

> BO28996.pep
MDSGYSSVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIV
RLGRGKFGISARVEWNYDTTEETMVEAVVYRSNSGDESDYKLLPWAIPKQ
TFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWPKRTYIGDKCVFEAE
GFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKMFASFLDH

BO28996.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG18537-PA 188 CG18537-PA 1..188 1..188 1017 100 Plus
CG18536-PA 191 CG18536-PA 9..191 6..188 631 60.7 Plus
CG18538-PA 182 CG18538-PA 17..181 24..187 525 58.3 Plus
CG18539-PB 185 CG18539-PB 6..184 7..187 512 51.4 Plus
CG14502-PD 188 CG14502-PD 13..187 8..187 491 46.7 Plus