Clone BO29005 Report

Search the DGRC for BO29005

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG9662-RA
Protein status:BO29005.pep: Imported from assembly
Sequenced Size:481

Clone Sequence Records

BO29005.complete Sequence

481 bp assembled on 2011-08-24

GenBank Submission: KX794264

> BO29005.complete
GAAGTTATCAGTCGACATGATCGAGACACTGTATAACCTGCCCTTCCACA
TCCTGGTGCCGCCGAACATCAAGGTGCGCAGATTCAGCATTCCAATGCCG
TCACCGATGGCCGTTTTCAGTGTGATTTTGTTTTCCTATTTTCTGGTGAC
AGGCGGTATCATATATGACGTGATTGTGGAGCCGCCCAGTCTGGGAGCCA
CGGTGGATGAGCACGGACACTCGCGTCCAGTGGCCTTTATGCCCTACCGT
GTGAATGGGCAGTACATCATGGAGGGCCTGGCCAGCAGCTTCCTGTTCAC
CGTCGGCGGACTGGGATTCATTATCATGGACCAAACGCACACGCCGGGCA
AGACGAACCTCAACCGCCTGCTGCTGACCGCCATGGGATTCATTTTCATC
CTGGTCTCCTTCTTCACCACCTGGCTGTTCATGCGCATGAAGCTGCCCAG
CTACCTGCAGCCCGCAAGCTTTCTAGACCAT

BO29005.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-RB 450 CG9662-PB 1..447 17..463 2235 100 Plus
CG9662-RA 450 CG9662-PA 1..447 17..463 2235 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-RB 846 CG9662-RB 118..565 16..463 2240 100 Plus
CG9662-RA 795 CG9662-RA 118..565 16..463 2240 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3376113..3376421 463..155 1545 100 Minus
2L 23513712 2L 3376479..3376620 157..16 710 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:30:56 has no hits.

BO29005.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:32 Download gff for BO29005.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 68..514 17..465 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:51 Download gff for BO29005.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 119..565 17..465 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:57 Download gff for BO29005.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 119..565 17..465 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:57 Download gff for BO29005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3376481..3376619 17..155 100   Minus
2L 3376111..3376420 156..465 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:51 Download gff for BO29005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3376481..3376619 17..155 100   Minus
arm_2L 3376111..3376420 156..465 99 <- Minus

BO29005.pep Sequence

Translation from 16 to 481

> BO29005.pep
MIETLYNLPFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIY
DVIVEPPSLGATVDEHGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLG
FIIMDQTHTPGKTNLNRLLLTAMGFIFILVSFFTTWLFMRMKLPSYLQPA
SFLDH

BO29005.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-PB 149 CG9662-PB 1..149 1..149 777 100 Plus
CG9662-PA 149 CG9662-PA 1..149 1..149 777 100 Plus