Clone BO29007 Report

Search the DGRC for BO29007

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptjanB-RA
Protein status:BO29007.pep: Imported from assembly
Sequenced Size:454

Clone Sequence Records

BO29007.complete Sequence

454 bp assembled on 2011-09-14

GenBank Submission: KX794405

> BO29007.complete
GAAGTTATCAGTCGACATGAAAATGTTCAAGTCATTGCGTCTGCTTCCTC
ATATTGTTTCTCCGTTTCAAAAATGTTACTCAACCGATTTGATAAGTTTG
GTAGGCGTTCCCCGGGTCAAGATAACCAAGGGTCAGAATCGTTATTTGTT
GGTGAATATTCATACGCATGGCTTCACGAAGTATGGAAGAGTTATTGTCC
GTGGCGCCGATGTTGACAATCACTTGGCGGTCTTCGACTCGATTTTGGAG
GAGCTGGAACCCGAGGGCATATGTGCCAAAATCCTCGGTGGTGGAAGGAT
TCTCAACGAGGCAGAAAATAAAAAAATTAAGATCTATGGCACCTCCAGGA
CTTTCGGCGGTGCTGATCACACAAGGACAAGGAATATACTTCAAGCGTGG
ACCACTTATAAGGACTTTAAGATAACCGTTAAACAAGCAAGCTTTCTAGA
CCAT

BO29007.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
janB-RA 423 CG7931-PA 1..420 17..436 2100 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
janB-RA 569 CG7931-RA 91..510 17..436 2100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30038373..30038528 224..69 780 100 Minus
3R 32079331 3R 30038191..30038315 349..225 625 100 Minus
3R 32079331 3R 30038043..30038130 436..349 440 100 Minus
3R 32079331 3R 30038587..30038638 68..17 260 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:16:36 has no hits.

BO29007.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:20 Download gff for BO29007.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 101..520 17..438 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:44 Download gff for BO29007.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 91..510 17..438 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:14 Download gff for BO29007.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 91..510 17..438 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:14 Download gff for BO29007.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30038587..30038638 17..68 100   Minus
3R 30038373..30038528 69..224 100 <- Minus
3R 30038191..30038315 225..349 100 <- Minus
3R 30038041..30038129 350..438 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:44 Download gff for BO29007.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25864309..25864360 17..68 100   Minus
arm_3R 25864095..25864250 69..224 100 <- Minus
arm_3R 25863913..25864037 225..349 100 <- Minus
arm_3R 25863763..25863851 350..438 97 <- Minus

BO29007.pep Sequence

Translation from 16 to 454

> BO29007.pep
MKMFKSLRLLPHIVSPFQKCYSTDLISLVGVPRVKITKGQNRYLLVNIHT
HGFTKYGRVIVRGADVDNHLAVFDSILEELEPEGICAKILGGGRILNEAE
NKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKITVKQASFLDH

BO29007.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
janB-PA 140 CG7931-PA 1..140 1..140 729 100 Plus
ocn-PA 148 CG7929-PA 1..137 1..136 306 43.1 Plus
CG18662-PA 146 CG18662-PA 29..137 27..136 198 36.9 Plus
janA-PA 119 CG7933-PA 5..119 27..143 165 35.3 Plus
janA-PC 119 CG7933-PC 5..119 27..143 165 35.3 Plus