Clone BO29011 Report

Search the DGRC for BO29011

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCheB42b-RA
Protein status:BO29011.pep: Imported from assembly
Sequenced Size:631

Clone Sequence Records

BO29011.complete Sequence

631 bp assembled on 2011-08-24

GenBank Submission: KX793760

> BO29011.complete
GAAGTTATCAGTCGACATGGTCATCATGATATTTGTGCTGCTACTCTTAT
TAGGAGTGACCAGTTCCTGGGCCACAGACTATGAATTATTGCTCGAGGAT
CCGGACATATTTTCGACGTGCACTGATGGTCCTCCCGGATCCATCAACAT
CCGCCAGGCACTCAACTTAGACGACATTGTAATCGACCAGAAAGGGGATA
TACTTCATGTATCCGGGAACGCCACCGTCGTGTGGGATGTGCAGCCCACC
GATCGGATTACTGCGAGACTTGATGTTTTTCACTTCAACCGCGGCACTTG
GGAGCCCACTGTCTTTAGCATGGCCACCCAGAACTTTTGCTCCATCATGT
ACGACAAGAACCAGTATTGGTATAAGTATTGGACAAGGTTTATAACCAAT
CGCCATGAGGTGGAAAAGAAGTGCTTCAGAGGGCCTGATACCGTTCTGGT
ACACGAGCCCTTCGATCTCATACTAAAATTTGAGAATTTTCGTGGACCTC
TTCTTAGAGGACGTCATAAACTTGTCATATTGTTTAACGCACTAGATGAG
AGGAATATACCGCGCCCAAACCCAATTTGTTTGGAGATCATAGGAGAACC
ACTAAAGTTGCAGGCAAGCTTTCTAGACCAT

BO29011.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42b-RA 591 CG33351-PA 1..588 26..613 2940 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42b-RA 674 CG33351-RA 1..597 17..613 2985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6943749..6943995 263..17 1235 100 Minus
2R 25286936 2R 6943507..6943683 439..263 885 100 Minus
2R 25286936 2R 6943173..6943346 613..440 870 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:30:27 has no hits.

BO29011.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:31 Download gff for BO29011.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..588 26..615 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:39 Download gff for BO29011.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..597 17..615 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:46 Download gff for BO29011.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..597 17..615 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:46 Download gff for BO29011.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6943750..6943995 17..262 100   Minus
2R 6943507..6943683 263..439 100 <- Minus
2R 6943171..6943346 440..615 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:39 Download gff for BO29011.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2831255..2831500 17..262 100   Minus
arm_2R 2831012..2831188 263..439 100 <- Minus
arm_2R 2830676..2830851 440..615 98 <- Minus

BO29011.pep Sequence

Translation from 16 to 631

> BO29011.pep
MVIMIFVLLLLLGVTSSWATDYELLLEDPDIFSTCTDGPPGSINIRQALN
LDDIVIDQKGDILHVSGNATVVWDVQPTDRITARLDVFHFNRGTWEPTVF
SMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKCFRGPDTVLVHEPFD
LILKFENFRGPLLRGRHKLVILFNALDERNIPRPNPICLEIIGEPLKLQA
SFLDH

BO29011.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42b-PA 196 CG33351-PA 1..196 4..199 1058 100 Plus
CheB42c-PB 196 CG33350-PB 4..195 7..198 633 56.8 Plus
CheB38c-PA 198 CG14405-PA 5..197 7..199 524 46.1 Plus
CheB38b-PA 197 CG33321-PA 5..192 7..194 485 42 Plus
CheB38a-PA 197 CG33320-PA 7..197 9..199 477 43.5 Plus