Clone BO29020 Report

Search the DGRC for BO29020

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptSfp78E-RA
Protein status:BO29020.pep: Imported from assembly
Sequenced Size:433

Clone Sequence Records

BO29020.complete Sequence

433 bp assembled on 2011-08-25

GenBank Submission: KX797252

> BO29020.complete
GAAGTTATCAGTCGACATGAATATCTTTATCTCCTTAATATTGGTAGTGC
TGGCCATTTTATCTTTTGCTGACCACACCGTGGCAGACGGAGATCGGCAC
CTAAATGAGGACTTAAATCGAGCGACGGTAAAGAAGACTAAGTATGGTTG
GCAATGTGCCGGGGTGACGTGCCCCATAAAGTTTACGGCATCTTGTAAGG
TAACAAAGGTCCTAAAGCCCTCTGATCTACAGCACACTGAGCTCCTGATT
TTGTGCATGGATAAAAACGATAAGCCTATGTGTGGGATAACACGAACTCG
AAAAGGGGTAATACAGGAAGTTCTGGACGTGGATGAAAACGGAAATACGA
TATATGACAAAAAGGAAGTTATTTCGGAGAACGATGGTACTAAAATCCCT
AGGTGCCCACGAAAGGCAAGCTTTCTAGACCAT

BO29020.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-RA 402 CG42607-PA 1..399 17..415 1995 100 Plus
Sfp78E-RB 453 CG42607-PB 117..450 82..415 1670 100 Plus
Sfp78E-RB 453 CG42607-PB 1..67 17..83 335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-RA 778 CG42607-RA 147..545 17..415 1995 100 Plus
Sfp78E-RB 805 CG1-RB 239..572 82..415 1670 100 Plus
Sfp78E-RB 805 CG1-RB 123..189 17..83 335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21683331..21683602 415..144 1360 100 Minus
3L 28110227 3L 21683776..21683842 83..17 335 100 Minus
3L 28110227 3L 21683665..21683726 143..82 310 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:54:43 has no hits.

BO29020.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-25 14:33:21 Download gff for BO29020.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 147..545 17..417 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:33 Download gff for BO29020.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 147..545 17..417 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:38 Download gff for BO29020.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 147..545 17..417 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:38 Download gff for BO29020.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21683777..21683842 17..82 100   Minus
3L 21683665..21683725 83..143 100 <- Minus
3L 21683329..21683602 144..417 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:33 Download gff for BO29020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21676877..21676942 17..82 100   Minus
arm_3L 21676765..21676825 83..143 100 <- Minus
arm_3L 21676429..21676702 144..417 99 <- Minus

BO29020.pep Sequence

Translation from 16 to 433

> BO29020.pep
MNIFISLILVVLAILSFADHTVADGDRHLNEDLNRATVKKTKYGWQCAGV
TCPIKFTASCKVTKVLKPSDLQHTELLILCMDKNDKPMCGITRTRKGVIQ
EVLDVDENGNTIYDKKEVISENDGTKIPRCPRKASFLDH

BO29020.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-PA 133 CG42607-PA 1..133 1..133 701 100 Plus
Sfp78E-PB 150 CG42607-PB 1..150 1..133 673 88.7 Plus