Clone BO29041 Report

Search the DGRC for BO29041

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptGlycogenin-RC
Protein status:BO29041.pep: Imported from assembly
Sequenced Size:856

Clone Sequence Records

BO29041.complete Sequence

856 bp assembled on 2011-08-24

GenBank Submission: KX794380

> BO29041.complete
GAAGTTATCAGTCGACATGAGCAAATTCGCTTGGGTGACGCTGACGACAA
ATGACACGTACTCACTGGGTGCCTTGGTCTTGGCCCACTCACTGAAAAGG
GCCAAGACCGCCCACCAGCTGGCCGTTCTGGTCACGCCCAATGTCTCGCA
GGCGATGCGCGACCGACTGAAGGAGGTCTACAATGTGGTGCAGGAGGTCA
ATGTGCTCGACTCACAGGATGCCGCCAATCTGGCGCTCCTCTCGCGACCC
GAACTAGGCGTGACCTTCACAAAACTCCACTGCTGGCGCCTCGTTCAGTT
TGAGAAGTGCGTCTTCCTGGATGCGGACACACTGGTCTTGCAAAACTGCG
ATGAGCTCTTCGAGCGCGAGGAACTGTCGGCTGCTCCGGATGTCAGCTGG
CCGGATTGCTTCAATTCCGGCGTGTTTGTGTTCAAACCTAGCGTGGACAC
CTTTGCCCAGATCACAGAGTTTGCCGTGAAGAATGGCAGCTTCGATGGCG
GTGACCAGGGTCTGCTGAATCAGTTCTTTGCCGACTGGTCGACGGCGGAC
ATTAAGAAGCATTTGCCATTTGTGTACAATGTGACGGCTTATGCCTCGTA
CTGTTATCTGCCCGCCTTCAAACAGTTCAGAGATAAGATTAAGATTTTGC
ATTTTGCCGGCAAGCTGAAGCCCTGGCTGATTCAGTTCAACTCGGAAACA
AAGGTGGCCAGCGTTTCGTCGGAGTATGCTCATGCCCAGGATTTGATTCA
GCTGTGGTGGAACATCTTTTGCGAAAATGTCATCCAGTCCCTGTCCACCG
AAATGATAATGATAACGATAGTGATCCCGCTAACCCACGCAAGCTTTCTA
GACCAT

BO29041.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-RH 1005 CG44244-PH 1..789 17..805 3945 100 Plus
Glycogenin-RG 1071 CG44244-PG 1..789 17..805 3945 100 Plus
Glycogenin-RD 1638 CG44244-PD 1..789 17..805 3945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-RH 2010 CG44244-RH 170..958 17..805 3945 100 Plus
Glycogenin-RG 2447 CG44244-RG 170..958 17..805 3945 100 Plus
Glycogenin-RD 3014 CG44244-RD 170..958 17..805 3945 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21204613..21204925 24..336 1565 100 Plus
2R 25286936 2R 21205009..21205301 334..626 1465 100 Plus
2R 25286936 2R 21205361..21205545 625..809 910 99.5 Plus
Blast to na_te.dros performed on 2014-11-27 06:50:34 has no hits.

BO29041.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:46 Download gff for BO29041.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RC 179..1000 17..840 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:08 Download gff for BO29041.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RD 170..958 17..805 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:55:50 Download gff for BO29041.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RD 170..958 17..805 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:55:50 Download gff for BO29041.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21210183..21210215 806..840 94   Plus
2R 21205361..21205541 625..805 100 -> Plus
2R 21205010..21205299 335..624 100 -> Plus
2R 21204609..21204923 17..334 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:08 Download gff for BO29041.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17097688..17097720 806..840 94   Plus
arm_2R 17092866..17093046 625..805 100 -> Plus
arm_2R 17092515..17092804 335..624 100 -> Plus
arm_2R 17092114..17092428 17..334 99 -> Plus

BO29041.pep Sequence

Translation from 16 to 856

> BO29041.pep
MSKFAWVTLTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDR
LKEVYNVVQEVNVLDSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVF
LDADTLVLQNCDELFEREELSAAPDVSWPDCFNSGVFVFKPSVDTFAQIT
EFAVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPA
FKQFRDKIKILHFAGKLKPWLIQFNSETKVASVSSEYAHAQDLIQLWWNI
FCENVIQSLSTEMIMITIVIPLTHASFLDH

BO29041.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-PD 545 CG44244-PD 1..270 1..270 1383 97.8 Plus
Glycogenin-PB 333 CG44244-PB 1..263 1..263 1380 100 Plus
Glycogenin-PH 334 CG44244-PH 1..263 1..263 1380 100 Plus
Glycogenin-PG 356 CG44244-PG 1..263 1..263 1380 100 Plus
Glycogenin-PE 699 CG44244-PE 1..263 1..263 1380 100 Plus