Clone BO29045 Report

Search the DGRC for BO29045

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptDen1-RC
Protein status:BO29045.pep: Imported from assembly
Sequenced Size:781

Clone Sequence Records

BO29045.complete Sequence

781 bp assembled on 2011-08-24

GenBank Submission: KX798514

> BO29045.complete
GAAGTTATCAGTCGACATGTTGCCCCACGATAGGAAAATACTTAGGCAAC
ATACACGCCAGAACCAGAATACGAATCGCCGGCGCCCCAGATTCACCAAC
AATAGCTTCCATACCAAAATGGGCAGCAACTCCAAGGCAGACCCCATCTC
GCTGACCTTCCACGACTCCTGCCTGCGGATGTCCGACGTCCAGTTGCTCC
ACGGCCCGCACTGGCTGAACGACCAGATCCTGAGCTTCTACTACGAATAC
CTGGCCCACATGAAGTACAAGACCAATGCGGATCTGCACTTCATTGCGCC
GGAGATTACGCAGTGTATGAAGTACATGGGCGACCAGGAGCTGAAGCAGC
TTCTCGACCAGAGCAACACCACTGGCAAGCCCTTTATCTTCTTCGCGCTG
AACGACAACGAAACCACCGATGCTGGTGGCAGCCACTGGTCACTGTTGGT
CTTCTCGCGTCCGGAGAAGACCTTCTATCACTTCGATTCGTATGGGAACA
ACAACACGGGCAACTCCCTGGAGCTGATGAACAAGATCAAGGACCTGCTT
GGCGTCCGAATGGCCAAATTCCGGCCCATGCGCTGCCTACAGCAGGCGAA
CGGCTACGACTGTGGCATCCATGTTATCTGCATGACCGACCACATTGCCG
ATTACCTAAACAGATACGAGGTGATCGACGGACTGCCGTCGCTGCACATC
GACACCGTGAAGGCGAAGCGCACCGAGCTACTGAAACTCATCCTGTCGCT
GGGCGGCAAGGGCGCAAGCTTTCTAGACCAT

BO29045.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-RC 750 CG8493-PC 1..747 17..763 3735 100 Plus
Den1-RA 648 CG8493-PA 1..645 119..763 3225 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-RC 1161 CG8493-RC 121..867 17..763 3735 100 Plus
Den1-RA 1257 CG8493-RA 245..963 45..763 3595 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12338531..12339250 44..763 3600 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:50:55 has no hits.

BO29045.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:47 Download gff for BO29045.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 126..867 22..765 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:19 Download gff for BO29045.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 126..867 22..765 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:01 Download gff for BO29045.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 126..867 22..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:01 Download gff for BO29045.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12338533..12339250 46..765 99   Plus
2R 12338425..12338448 22..45 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:19 Download gff for BO29045.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8226038..8226755 46..765 99   Plus
arm_2R 8225930..8225953 22..45 100 -> Plus

BO29045.pep Sequence

Translation from 16 to 781

> BO29045.pep
MLPHDRKILRQHTRQNQNTNRRRPRFTNNSFHTKMGSNSKADPISLTFHD
SCLRMSDVQLLHGPHWLNDQILSFYYEYLAHMKYKTNADLHFIAPEITQC
MKYMGDQELKQLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPE
KTFYHFDSYGNNNTGNSLELMNKIKDLLGVRMAKFRPMRCLQQANGYDCG
IHVICMTDHIADYLNRYEVIDGLPSLHIDTVKAKRTELLKLILSLGGKGA
SFLDH

BO29045.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-PC 249 CG8493-PC 1..249 1..249 1343 100 Plus
Den1-PA 215 CG8493-PA 1..215 35..249 1156 100 Plus
CG1503-PB 307 CG1503-PB 53..299 15..247 335 33.6 Plus
CG1503-PA 307 CG1503-PA 53..299 15..247 335 33.6 Plus