Clone BO29052 Report

Search the DGRC for BO29052

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:52
Vector:pDNR-Dual
Associated Gene/Transcriptgalectin-RE
Protein status:BO29052.pep: Imported from assembly
Sequenced Size:1291

Clone Sequence Records

BO29052.complete Sequence

1291 bp assembled on 2011-08-24

GenBank Submission: KX794560

> BO29052.complete
GAAGTTATCAGTCGACATGGATGCCTTGGACGGTACGACAATGGAACTGC
ACAACAGTTTTCTACAGGTGGAGAGCACAACACACTTTCCTTTGGATTGC
ATCAGCGACATCGAGGTGGTGGATGGAAATGAATTAAAAGCCTCATTTTA
CGAATATGCAGATGCTGTGCCAAAATATTTTAACGACCAAATAGGGAAAT
TGAGCGAAGGGATAAGTTTCACGGTGACTGGGAATCTCTCTGTAAACTGC
GAGAGGTTTTCCATCAATCTGGTTTATAACAATGACTCTCGAGATGTGGC
GCTCCACATTAATCCACGGTTGCCACAAAACTATATTGTCCGCAACACCA
AAGTACAGGACATTTGGGGAAACGAGGAAGTGTCCTCGGCATTGCCGTTT
CTACTAAGTCGAGGCGAGGAGTTTTCCATTCAAGTGCTAGTTACTGAGGC
ATGCTATATGATATCGGTAAACGGACAACACTTTGCAGCGTACACTCATC
GAATCCCTTATAGGGATGTTCGCATTCTGGAAGTGAAGGGAGATGTAAGT
AACGTGGAAATGAAGCGAACTTTGGTCTTAAAATATCCTGAGCGATTACC
CCAGTCAGAGGCTAATAACATTGAGCTTCACATAGATGATGGGATTAATG
AAATTGATGCCAGCGTTGAGGAGACTGTTAAAATACCTCATGAGTGGTGC
ATTATTAGCGCCCCGAACACACAGTCGGACAGTTCGCCTAAGCGTAACAA
TAGTTCGAATGATCTTGGCCTTACTTTGCCTTATTATGGAGCATTGCCAC
CAAATTCGTTGGTCGATGGTCGATGCTTGAAGATTGAAGGGAGAGTGCGA
TTACTTCCCCACTCGTTTTATATAAACCTGCAACAGGGGCAGGACATATG
GCCACATCCAGTAATTGCATTCCACTTAAACCCACGTTTTTCGAAAGCAA
GCAGCGGCGCTATTGGAAAGGCGGTGGTGTGTAGGAATGCCTGGCTTAAT
GGAGCTTGGGCACAAGAAGAGCGTTCGGAGTTTGACACAAACTTTCGCCC
TGGTCGGTCTTTTTGTTTAGCCATTGTTTGTACCAAAACATCCTTTGAGG
TGTATGTCAATCGGCAGTTTATGACTGATTTTAAATATAAGGTTAGCCCT
GAGGTGGTGGACACTGTCTACATACAAGGAGATGTTAAACTTTGGAATGT
AACGCTGGAAAAAAATCAGATGATTAAAGGCAAAAATATGCGAGTCTATC
AGAATCCGTGGTTCTTTAGTGAGGCAAGCTTTCTAGACCAT

BO29052.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-RE 1260 CG11372-PE 1..1257 17..1273 6285 100 Plus
galectin-RA 1512 CG11372-PA 253..1509 17..1273 6075 98.9 Plus
galectin-RD 1206 CG11372-PD 70..1203 140..1273 5670 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-RE 1458 CG11372-RE 86..1342 17..1273 6285 100 Plus
galectin-RA 1841 CG11372-RA 469..1725 17..1273 6075 98.9 Plus
galectin-RF 1536 CG11372-RF 287..1420 140..1273 5670 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 75076..76095 254..1273 5100 100 Plus
2L 23513712 2L 73570..73693 17..140 620 100 Plus
2L 23513712 2L 74903..75020 140..257 590 100 Plus
2L 23513712 2L 72855..72978 17..140 410 88.7 Plus
Blast to na_te.dros performed on 2014-11-27 06:52:43 has no hits.

BO29052.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:48 Download gff for BO29052.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 86..1342 17..1275 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:28 Download gff for BO29052.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 86..1342 17..1275 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:56 Download gff for BO29052.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 86..1342 17..1275 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:56 Download gff for BO29052.complete
Subject Subject Range Query Range Percent Splice Strand
2L 75078..76095 256..1275 99   Plus
2L 74903..75018 140..255 100 -> Plus
2L 73570..73692 17..139 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:28 Download gff for BO29052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 75078..76095 256..1275 99   Plus
arm_2L 74903..75018 140..255 100 -> Plus
arm_2L 73570..73692 17..139 100 -> Plus

BO29052.pep Sequence

Translation from 16 to 1291

> BO29052.pep
MDALDGTTMELHNSFLQVESTTHFPLDCISDIEVVDGNELKASFYEYADA
VPKYFNDQIGKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINP
RLPQNYIVRNTKVQDIWGNEEVSSALPFLLSRGEEFSIQVLVTEACYMIS
VNGQHFAAYTHRIPYRDVRILEVKGDVSNVEMKRTLVLKYPERLPQSEAN
NIELHIDDGINEIDASVEETVKIPHEWCIISAPNTQSDSSPKRNNSSNDL
GLTLPYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVI
AFHLNPRFSKASSGAIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFC
LAIVCTKTSFEVYVNRQFMTDFKYKVSPEVVDTVYIQGDVKLWNVTLEKN
QMIKGKNMRVYQNPWFFSEASFLDH

BO29052.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-PE 419 CG11372-PE 1..419 1..419 2219 100 Plus
galectin-PA 503 CG11372-PA 85..503 1..419 2150 97.1 Plus
galectin-PB 402 CG11372-PB 24..402 41..419 2006 99.7 Plus
galectin-PD 401 CG11372-PD 24..401 42..419 2005 100 Plus
galectin-PF 272 CG11372-PF 1..272 148..419 1454 100 Plus