Clone BO29055 Report

Search the DGRC for BO29055

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:55
Vector:pDNR-Dual
Associated Gene/Transcriptelfless-RB
Protein status:BO29055.pep: Imported from assembly
Sequenced Size:721

Clone Sequence Records

BO29055.complete Sequence

721 bp assembled on 2011-09-14

GenBank Submission: KX797846

> BO29055.complete
GAAGTTATCAGTCGACATGGGTGATTCCAGCGACTCAGACTCTTCTACTG
AATGGGAGCAGAACACTAGGGTTATTTCCTTACCCTTTTCCAGAAACCGT
TCACATTTGAGCTCTCGCCTCAGTTACCTGGTGGGACTTCAAATGGAAAA
CTTCAGGACCTCGAATAATTCTGGAGTATCACAGCGAATCCATAACACCG
GGCCCACTCCCGTACTCGCGCCCTCCGGATTAAGATCCCGCTTACTCAGC
GGTTCCTCTGAGCGGAATCCAAATGAGTATTACGGAGACTCGGACTCCTC
AAGCAGCAGCAGATCTATCGACAGAACCCCATTCCTGTTGGAGTATTCCA
GCGACTCAGAGTCGTCTAGTTCCAGTGATAGTGAAAGCTCATCGACCAGC
ATTAGCTTCGATAGCAGTATGAGCTCCACCGAATCATCAACACCAATGGG
ACATACAGAATCCTCAGATTCAAACGAGGATTCTCCTCCCAACAAACGGA
TCAAATCAGATGACGAGGAGTCCAAGAAATCTGTCTTGCCCTACAACTGC
CCTGTGTGCCTGGAAGATGTCCGCGAGAAGCTACCAGTGTCCACCAATTG
TGGCCACGTTTTCTGCAAAGCGTGCATTAAGAGAGCTGTCGACACTGGCA
GGGTATGCCCATTGTGCGGAGTGGATGAGCCCGAATTCCATCGTATTTTC
TTGGCAAGCTTTCTAGACCAT

BO29055.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-RC 690 CG15150-PC 1..687 17..703 3435 100 Plus
elfless-RB 690 CG15150-PB 1..687 17..703 3435 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-RC 1376 CG15150-RC 100..786 17..703 3435 100 Plus
elfless-RB 1643 CG15150-RB 100..786 17..703 3435 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18010500..18010866 703..337 1835 100 Minus
2L 23513712 2L 18011077..18011207 260..130 655 100 Minus
2L 23513712 2L 18011261..18011376 132..17 580 100 Minus
2L 23513712 2L 18010934..18011011 337..260 390 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:20:51 has no hits.

BO29055.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:24 Download gff for BO29055.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RC 100..786 17..705 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:12:41 Download gff for BO29055.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 100..786 17..705 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:08:46 Download gff for BO29055.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 100..786 17..705 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:08:46 Download gff for BO29055.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18011263..18011376 17..130 100   Minus
2L 18011078..18011206 131..259 100 <- Minus
2L 18010934..18011011 260..337 100 <- Minus
2L 18010498..18010865 338..705 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:12:41 Download gff for BO29055.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18011263..18011376 17..130 100   Minus
arm_2L 18011078..18011206 131..259 100 <- Minus
arm_2L 18010934..18011011 260..337 100 <- Minus
arm_2L 18010498..18010865 338..705 99 <- Minus

BO29055.pep Sequence

Translation from 16 to 721

> BO29055.pep
MGDSSDSDSSTEWEQNTRVISLPFSRNRSHLSSRLSYLVGLQMENFRTSN
NSGVSQRIHNTGPTPVLAPSGLRSRLLSGSSERNPNEYYGDSDSSSSSRS
IDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESS
DSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFC
KACIKRAVDTGRVCPLCGVDEPEFHRIFLASFLDH

BO29055.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-PC 229 CG15150-PC 1..229 1..229 1186 100 Plus
elfless-PB 229 CG15150-PB 1..229 1..229 1186 100 Plus
dgrn-PD 205 CG10981-PD 42..205 42..229 183 30.7 Plus
dgrn-PB 312 CG10981-PB 149..312 42..229 183 30.7 Plus
dgrn-PA 319 CG10981-PA 156..319 42..229 183 30.7 Plus