Clone BO29061 Report

Search the DGRC for BO29061

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG11498-RB
Protein status:BO29061.pep: Imported from assembly
Sequenced Size:1627

Clone Sequence Records

BO29061.complete Sequence

1627 bp assembled on 2011-08-24

GenBank Submission: KX799102

> BO29061.complete
GAAGTTATCAGTCGACATGGCGGACAGCAGGGAACGGATTCGTGGACCCT
CCAGGGATGGTCGCGAGTTCCTGACCAGTCCGCGTCAGGTTCTTCGTCGG
CTGATGCTCCTCTCGGAGGGCAGACAGTACAGGGAGGCTGCTGGCGTGGT
GGGCAGACTGGGTCCCTCGGTTCTCAGATCAGTGATCGCTGAGCTTCCGC
TGGACCTGCTGCTGGAGCACCTGCCTCACAGTGCCTACCTTCTGGAGTCT
TTCTTTACCAGATTGACCACCCTGAACACCACTCCCAAGCCAGATGTGCC
TAGTGAAACGGTGGCCTGGCAGTTGGTGCGTCTGTTCGCTAATCCCCATG
AATCAGGACTCCGGCAGAGATGCACTCGACTCCTGCAGGCCTTGGCTCAG
TACGAACCAGGGCTCCGGCAGACTTTGAGGGAAAGAAGACGCAGTTTTGA
TAACGCTGTACAAGGTCTTGGGGTCCATGGACTGACCACCGATGCCTCGG
GTCAGCTTATTTCCCTACATGTAGCCCTGAAAACCGAGCTGCAACGCCAT
GTGGATACCTACAAGATGGCCATTCACAAGCTGGAGGAGCTGAGCATGGT
GACTGTCAACCAAGACCCTGCTCACTCCTCCCATCAACGATTGTTGGCCA
TCAATTATGGGGATATTCAGCAGCGACTGATCGACAACAAGACCCTGCTC
ACAATGCTAGACAAGCCGGCTCTCAAGCAGCTCCAAACCCTGGTCGAGAA
CCTCAGCACGCGGGTGGAGAACGACAAGGAGGTGCTCACCTGCGTGGGTC
AGGTGCGTCGTCTGGACGCACAGGCGCTCGTGGAGAAACGCCCTGCCGCC
GGTCTGCTGATGAACTTCTCCCGCGGCTGCGAGGTGGTGCTCCACATGAT
GGGCCCTGAAGGAGGTCCTCCGGGCTCCTCCCACTCCATTGGAAAGACCA
CTCCCCCAGGCGGCGCTAGCACGAGCAGCTGCAGCGATGGATATCACTCG
GACGACTCTGGAAGCGATGACAGCAGCGAAATGGTGTCGCTCTATCGGAA
TCTCTACGTCGAGAACCGAGCGGACGCCTTGGAGGCGTTGGACAGTCTTC
CCCAGATAAAACACGCGCACAGCCTCAAGGGGAAGATACTCTTCTCCATG
ATCGTGCTCTCCTTCCGCCTGTGCCACGGAATGCGGGAGCGAAAGGTCCT
GGAAGTTCGGCGAGTCCTGAATTGCCCCTTGGACAGCAGCAGTGAGACCA
CCTTGTCCCTGGACAGATCCGTTCGCCAGCACCTCTTCGAGACCGCCGAG
AGTTTCCCGTTGGGCGAGATCGAGCGGTCGGTGTTCAACCAGGTGCTATC
TACTCTGCACGAGTACCCCTGCCTGGAGTCCTGCCCCCCGTTGACGCACT
ACGTCAGTGCCTGTGTCCGACTGGCCTGGAGGATGATCAACCAGAAGGCG
CCGTACTACCTGGACATGGACTTCAACCTGGGTTTCCTGAGGCCCGAGAA
ACACGAGCGGCATCCCCAGGCGGACCGGCGATCGGATCTGATAAAAGCCT
TCCTCTGGCCCGCCCTGATGCAGAACAACCAGTGCGCCTTCAAGGCGGTG
GTGGCCACCGCAAGCTTTCTAGACCAT

BO29061.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-RC 1596 CG11498-PC 1..1593 17..1609 7965 100 Plus
CG11498-RB 1596 CG11498-PB 1..1593 17..1609 7965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-RC 2348 CG11498-RC 686..2278 17..1609 7965 100 Plus
CG11498-RB 2506 CG11498-RB 844..2436 17..1609 7965 100 Plus
CG15529-RB 1393 CG15529-RB 973..1300 1483..1156 1640 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30155059..30155826 1026..259 3840 100 Minus
3R 32079331 3R 30153279..30153606 1483..1156 1640 100 Minus
3R 32079331 3R 30155915..30156159 261..17 1225 100 Minus
3R 32079331 3R 30154754..30154886 1156..1024 665 100 Minus
3R 32079331 3R 30153092..30153220 1609..1481 645 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:53:19 has no hits.

BO29061.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:50 Download gff for BO29061.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 844..2436 17..1611 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:52 Download gff for BO29061.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 844..2436 17..1611 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:18 Download gff for BO29061.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 844..2436 17..1611 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:18 Download gff for BO29061.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30155915..30156159 17..261 100   Minus
3R 30155059..30155823 262..1026 100 <- Minus
3R 30154754..30154883 1027..1156 100 <- Minus
3R 30153281..30153605 1157..1481 100 <- Minus
3R 30153089..30153219 1482..1611 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:52 Download gff for BO29061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25981637..25981881 17..261 100   Minus
arm_3R 25980781..25981545 262..1026 100 <- Minus
arm_3R 25980476..25980605 1027..1156 100 <- Minus
arm_3R 25979003..25979327 1157..1481 100 <- Minus
arm_3R 25978811..25978941 1482..1611 98 <- Minus

BO29061.pep Sequence

Translation from 16 to 1627

> BO29061.pep
MADSRERIRGPSRDGREFLTSPRQVLRRLMLLSEGRQYREAAGVVGRLGP
SVLRSVIAELPLDLLLEHLPHSAYLLESFFTRLTTLNTTPKPDVPSETVA
WQLVRLFANPHESGLRQRCTRLLQALAQYEPGLRQTLRERRRSFDNAVQG
LGVHGLTTDASGQLISLHVALKTELQRHVDTYKMAIHKLEELSMVTVNQD
PAHSSHQRLLAINYGDIQQRLIDNKTLLTMLDKPALKQLQTLVENLSTRV
ENDKEVLTCVGQVRRLDAQALVEKRPAAGLLMNFSRGCEVVLHMMGPEGG
PPGSSHSIGKTTPPGGASTSSCSDGYHSDDSGSDDSSEMVSLYRNLYVEN
RADALEALDSLPQIKHAHSLKGKILFSMIVLSFRLCHGMRERKVLEVRRV
LNCPLDSSSETTLSLDRSVRQHLFETAESFPLGEIERSVFNQVLSTLHEY
PCLESCPPLTHYVSACVRLAWRMINQKAPYYLDMDFNLGFLRPEKHERHP
QADRRSDLIKAFLWPALMQNNQCAFKAVVATASFLDH

BO29061.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-PC 531 CG11498-PC 1..531 1..531 2734 100 Plus
CG11498-PB 531 CG11498-PB 1..531 1..531 2734 100 Plus