Clone BO29068 Report

Search the DGRC for BO29068

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG31515-RB
Protein status:BO29068.pep: Imported from assembly
Sequenced Size:421

Clone Sequence Records

BO29068.complete Sequence

421 bp assembled on 2011-08-24

GenBank Submission: KX796694

> BO29068.complete
GAAGTTATCAGTCGACATGCGGATCAATCTCATCTACTTCACGCTGCTTT
GGGCATTCTTCTTCTCAACCGAAGTATTTGGAAAGGTTAAAATACGAGAG
TCCGATATACGACGTATAACAAAGATGGGAAGCTACAAGGTACGCCAAGA
AAAATGTTTGTTCATACCCAGCTATGGACGCTGCAAAAAACATATCGCAG
TATATGGCTACAACATTATAACCAATCGATGCTCAGAATTTACCTACAGT
GGCTGCGGGGGGAATCCCAATCGTTTTATGACTGATAGCCAATGTCGAAA
CACTTGCTATGTGGTTCCAGCGAGGAAAACCGTCTCAGAACCGGACTATT
ATGCCGATGACGGTGTCACAGAACCGATGCAAGTGGATGAAGAGGACGAT
TACGCAAGCTTTCTAGACCAT

BO29068.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG31515-RB 390 CG31515-PB 1..387 17..403 1935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31515-RB 469 CG31515-RB 27..414 16..403 1940 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23388428..23388683 403..148 1280 100 Minus
3R 32079331 3R 23388739..23388872 149..16 670 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:29:02 has no hits.

BO29068.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:29 Download gff for BO29068.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 28..414 17..405 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:05 Download gff for BO29068.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 28..414 17..405 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:14 Download gff for BO29068.complete
Subject Subject Range Query Range Percent Splice Strand
CG31515-RB 28..414 17..405 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:14 Download gff for BO29068.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23388739..23388871 17..149 100   Minus
3R 23388426..23388681 150..405 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:05 Download gff for BO29068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19214461..19214593 17..149 100   Minus
arm_3R 19214148..19214403 150..405 99 <- Minus

BO29068.pep Sequence

Translation from 16 to 421

> BO29068.pep
MRINLIYFTLLWAFFFSTEVFGKVKIRESDIRRITKMGSYKVRQEKCLFI
PSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTCYVV
PARKTVSEPDYYADDGVTEPMQVDEEDDYASFLDH

BO29068.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31515-PB 129 CG31515-PB 1..129 1..129 704 100 Plus
CG31609-PB 123 CG31609-PB 24..94 40..108 178 45.1 Plus
CG17380-PB 119 CG17380-PB 17..75 39..97 155 45.8 Plus
CG2816-PB 84 CG2816-PB 22..81 38..97 133 41.7 Plus