Clone BO29069 Report

Search the DGRC for BO29069

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:290
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG34041-RD
Protein status:BO29069.pep: Imported from assembly
Sequenced Size:694

Clone Sequence Records

BO29069.complete Sequence

694 bp assembled on 2011-08-24

GenBank Submission: KX798707

> BO29069.complete
GAAGTTATCAGTCGACATGTATTATTTTCCTACCTCAGTCATGTGGAGCG
CTCTTGGTTTTTCGCCTCTTTTGGCTGTTTTGATTTTACCCAAATGGGCC
TCTTCTACAAAGATGAAAGCCTATTTAGATCTCGATACCCGATTAAAGAC
ACAATTACGGGGCTACTCGGAAGACCTGCAGGATCACATTAGTACCTTAA
ATCGTTATATAGATGATCGAAAATCTGAGCTAGATAAAGTGGGAAAAGAT
CCTGAAGTGTATCTGGGCAATCCTCTTAATAGCTTCTCTTTATTACACCA
TTTGCACTTTGATTGGCCAGCTTGGAGAAAGCTAATGGAAAAGCCCTTAG
CCACAGAGTACATAACCGAGATTCAAGAGATGTGGAGCGAGATGCCAACG
AAAGATGAATATACGAATTCCATTAAAGCTGCCAAGGATTTCCATAAGAA
CGAAACTCAGGGAAATTTTGAATTTAGTCCTTTGGAGTCTCTGCAAATCG
CTCTGCATGCATACGACAAGAAAAACTATACGGAGGCGGAGAACTGGCTA
AATATTACCTTAAATGGTTATAAAAACCTCAGTCTCCAAGAAAAGGATCT
TTATGAAGTTCTAAGTCCTGTTAGTGAGAGTCAGGTGGAGGATCTTTATA
CCAAAGTCAGGAAAATAAAAAATGAAGCAAGCTTTCTAGACCAT

BO29069.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34041-RD 663 CG34041-PD 1..660 17..676 3300 100 Plus
CG34041-RF 1707 CG34041-PF 1..607 17..623 3035 100 Plus
CG34041-RE 1650 CG34041-PE 1..607 17..623 3035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34041-RD 697 CG34041-RD 27..686 17..676 3300 100 Plus
CG34041-RF 1733 CG34041-RF 27..633 17..623 3035 100 Plus
CG34041-RE 1676 CG34041-RE 27..633 17..623 3035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30508663..30508864 475..676 1010 100 Plus
3R 32079331 3R 30508049..30508248 17..216 970 99 Plus
3R 32079331 3R 30508286..30508438 204..356 765 100 Plus
3R 32079331 3R 30508494..30508616 355..477 615 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:29:37 has no hits.

BO29069.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:35:29 Download gff for BO29069.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 27..676 17..666 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:19 Download gff for BO29069.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 27..676 17..666 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:29 Download gff for BO29069.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 27..676 17..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:29 Download gff for BO29069.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30508666..30508854 478..666 100   Plus
3R 30508496..30508616 357..477 100 -> Plus
3R 30508287..30508438 205..356 100 -> Plus
3R 30508049..30508236 17..204 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:19 Download gff for BO29069.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26334388..26334576 478..666 100   Plus
arm_3R 26334218..26334338 357..477 100 -> Plus
arm_3R 26334009..26334160 205..356 100 -> Plus
arm_3R 26333771..26333958 17..204 100 -> Plus

BO29069.pep Sequence

Translation from 16 to 694

> BO29069.pep
MYYFPTSVMWSALGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGY
SEDLQDHISTLNRYIDDRKSELDKVGKDPEVYLGNPLNSFSLLHHLHFDW
PAWRKLMEKPLATEYITEIQEMWSEMPTKDEYTNSIKAAKDFHKNETQGN
FEFSPLESLQIALHAYDKKNYTEAENWLNITLNGYKNLSLQEKDLYEVLS
PVSESQVEDLYTKVRKIKNEASFLDH

BO29069.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34041-PD 220 CG34041-PD 1..220 1..220 1164 100 Plus
CG34041-PE 549 CG34041-PE 1..202 1..202 1076 100 Plus
CG34041-PF 568 CG34041-PF 1..202 1..202 1076 100 Plus
CG31021-PB 453 CG31021-PB 2..198 37..223 275 28.7 Plus
PH4alphaPV-PA 525 CG31015-PA 39..227 33..213 213 27.2 Plus