Clone BO29101 Report

Search the DGRC for BO29101

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptNpc2e-RB
Protein status:BO29101.pep: Imported from assembly
Sequenced Size:538

Clone Sequence Records

BO29101.complete Sequence

538 bp assembled on 2011-08-26

GenBank Submission: KX799806

> BO29101.complete
GAAGTTATCAGTCGACATGCTGCGAATCGTTGTAACTTTGGCTCTAATTC
TGGCCACAGTCAATGCCACCAATGTCCAGCAGTGCAAAAATAAGCCGTTT
CCACTGGATGTGAATATTAAGGATTGCGAGGAACCGCCGTGCGTTGTGTA
CAAAGGAACCATAGCAGTCATGGAGGTGCACTTCCTGGGCAATAACAACA
ATATCAAGAGCATTACGGCCACCACAACGGCAAAGGTTTTGGGCATGAAT
CTGCCATATGCCCTACCCGACGAAGTGTCCGATGTGTGCCGCAATCTCCT
GTACGGTGCCATCTGTCCCATCGACAAGGACGAGGATGTCACGTATCAGT
TCAACTTCTATGTGGAGCCTTCGTTCCCGGAAATAACGGCGGATGTCACT
GTCACGTTGAACGATGCGCAGAACGAACCGATCACCTGCTTCGTCGTGAG
CTGTAAAATCCGGAAGGGAGCCACTGCAGCACAGATGGACGGATATCTGT
TGGACTGGACGAACCCCCTTGCAAGCTTTCTAGACCAT

BO29101.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2e-RB 507 CG31410-PB 1..504 17..520 2520 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2e-RB 661 CG31410-RB 67..570 17..520 2520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10053929..10054257 192..520 1645 100 Plus
3R 32079331 3R 10053763..10053874 84..195 545 99.1 Plus
3R 32079331 3R 10053398..10053465 17..84 340 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:12:03 has no hits.

BO29101.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:11 Download gff for BO29101.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..504 17..522 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:50:08 Download gff for BO29101.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 67..570 17..522 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:54:05 Download gff for BO29101.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 67..570 17..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:54:05 Download gff for BO29101.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10053929..10054257 192..522 99   Plus
3R 10053763..10053870 84..191 100 -> Plus
3R 10053398..10053464 17..83 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:50:08 Download gff for BO29101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5879651..5879979 192..522 99   Plus
arm_3R 5879485..5879592 84..191 100 -> Plus
arm_3R 5879120..5879186 17..83 100 -> Plus

BO29101.pep Sequence

Translation from 16 to 538

> BO29101.pep
MLRIVVTLALILATVNATNVQQCKNKPFPLDVNIKDCEEPPCVVYKGTIA
VMEVHFLGNNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAIC
PIDKDEDVTYQFNFYVEPSFPEITADVTVTLNDAQNEPITCFVVSCKIRK
GATAAQMDGYLLDWTNPLASFLDH

BO29101.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2e-PB 168 CG31410-PB 1..168 1..168 887 100 Plus
Npc2d-PA 173 CG12813-PA 7..173 4..166 272 38 Plus
Npc2c-PA 165 CG3934-PA 7..164 2..154 265 35.4 Plus