Clone BO29106 Report

Search the DGRC for BO29106

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG16733-RA
Protein status:BO29106.pep: Imported from assembly
Sequenced Size:982

Clone Sequence Records

BO29106.complete Sequence

982 bp assembled on 2011-08-26

GenBank Submission: KX795679

> BO29106.complete
GAAGTTATCAGTCGACATGCAGCTAATTTATCGTGAACTCGAGGAGGACA
TACTTCGACGCACTAATGCAGTCTTTCCGGTACAAAATTGCTTTGTTGAG
GTCCTCCCCGATCAGTTTATCATTCCCAGAAAGTACGTGGAGCTGGGCGA
ATCGATTCGATCGCTTCCCGTTTACCAGGACGACGTATGGATGGTGTCCT
ATCCACGAACCGGATCGACGTGGGCCCAGGAGATGGTCTGGCTGCTGGGT
CACCAATTGGATTACGTGGCCGCTGAGCAAGATTTAAGATTGCGATCTCC
GCTCATTGAACTATCCGCTTTGTTTAGCATCGATCATCACGAGACGGTGG
CCCAAAAGTTTGGCAATACCGTGGATCTGGTTCGCAATCTGCCACGCCCA
CGTTTTGCACGCTCCCACCTGCCGTGGCCTTTGCTACCCGAGCAATTTGA
GACGGTAAAGCCGAGGATCGTGTATACTGCTCGAAATCCCAAGGATCTTT
GCGTCTCGTACTATCACTACTTCAAGTTGCTGCACGGCATGAATGGGGAC
TTTGAGCAATTCGTGGATCTCTTCCTGGAGGGGCACACACCGATGGGATC
CTATTGGCGGCACGTCCTGCCCTTTTGGAAACGTAGCCAGGATGATAATG
TGCTGTTCATCAAGTACGAGGACATGGTCAAGGATCTGCCCAGTGTAGTT
CGCCGCTGTGCCAGATTCCTGGGCGTTCAAAGTCTCCTCGATGTGAGCAC
TTTGCAGAAATTGTGCGATCACCTCACATTCGACAAGATGCGGGCGAACA
AGGCGGTGAATCTGGAGAAGCTGCTCCCGGAATCATCTTCCAAGTTCATA
CGCAATGGCAAGATCGGGGATTGGCGCAATCACATGGGCAATGAGATGTC
GGAACGCTTTGATGAATGGACCGAGAGACATATGCGTGGTTCTGGATTAA
ACTTTGACTACGTGGCAAGCTTTCTAGACCAT

BO29106.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
St2-RB 951 CG16733-PB 1..948 17..964 4740 100 Plus
St2-RA 951 CG16733-PA 1..948 17..964 4740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
St2-RB 1528 CG16733-RB 28..976 16..964 4745 100 Plus
St2-RA 1137 CG16733-RA 28..976 16..964 4745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9252350..9252962 352..964 3065 100 Plus
3R 32079331 3R 9251870..9252205 16..351 1680 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:51:34 has no hits.

BO29106.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 15:31:18 Download gff for BO29106.complete
Subject Subject Range Query Range Percent Splice Strand
CG16733-RA 19..966 17..966 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:36:26 Download gff for BO29106.complete
Subject Subject Range Query Range Percent Splice Strand
St2-RA 29..976 17..966 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:11:43 Download gff for BO29106.complete
Subject Subject Range Query Range Percent Splice Strand
St2-RA 29..976 17..966 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:11:43 Download gff for BO29106.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9252350..9252962 352..966 99   Plus
3R 9251871..9252205 17..351 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:36:26 Download gff for BO29106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5078072..5078684 352..966 99   Plus
arm_3R 5077593..5077927 17..351 100 -> Plus

BO29106.pep Sequence

Translation from 16 to 982

> BO29106.pep
MQLIYRELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSL
PVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELS
ALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPR
IVYTARNPKDLCVSYYHYFKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHV
LPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLC
DHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDE
WTERHMRGSGLNFDYVASFLDH

BO29106.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
St2-PB 316 CG16733-PB 1..316 1..316 1697 100 Plus
St2-PA 316 CG16733-PA 1..316 1..316 1697 100 Plus
St1-PB 338 CG5428-PB 58..332 45..319 431 31.2 Plus
St4-PB 346 CG6704-PB 34..341 26..307 374 29 Plus
St4-PA 346 CG6704-PA 34..341 26..307 374 29 Plus