Clone BO29108 Report

Search the DGRC for BO29108

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG18735-RA
Protein status:BO29108.pep: Imported from assembly
Sequenced Size:1126

Clone Sequence Records

BO29108.complete Sequence

1126 bp assembled on 2011-09-14

GenBank Submission: KX793982

> BO29108.complete
GAAGTTATCAGTCGACATGTGTAATTTTCATCTTCTGCTGATTCTTGCCA
CAGCACTGGGCGATTTGGCTTGTGCCACGCCCTCTCTGCGTTCCGCCTCC
GATCCTGAGAAGATCTTAAACAATCTAGCTCAACTAAGGCAGAGTAGCTT
TCTGGACTGGATTCAATCGATCCTGGGACCCGAGGTGCCAGCCGAATGGA
GCTCTCCGGCCAAAAGGGAGTGCGCAGAGTGCTCCTGTGGTAATATCAAT
ACTCGTCATCGCATCGTCGGAGGTCAGGAGACGGAGGTCCATGAGTATCC
CTGGATGATAATGCTCATGTGGTTCGGTAATTTCTATTGCGGCGCTTCTT
TGGTTAACGATCAGTATGCCTTAACCGCTGCCCATTGTGTAAATGGCTTC
TACCATCGTTTGATCACGGTCCGATTGCTGGAGCATAATCGTCAGGATAG
CCACGTCAAGATCGTGGATCGCCGGGTTTCCAGGGTGCTCATCCACCCGA
AGTACAGCACCAGGAACTTTGACAGTGACATTGCTTTGATTCGTTTCAAT
GAACCAGTTCGTCTTGGCATCGATATGCATCCAGTATGCATGCCCACTCC
GAGCGAAAATTATGCGGGTCAAACTGCCGTGGTCACCGGATGGGGAGCTC
TGAGTGAGGGCGGACCAATTTCTGATACCCTCCAGGAGGTGGAAGTGCCC
ATCCTCAGCCAAGAAGAGTGCCGCAATAGCAACTACGGCGAGTCCAAGAT
TACCGACAACATGATCTGTGCCGGCTACGTGGAGCAAGGTGGCAAGGACT
CCTGCCAAGGAGACAGCGGTGGACCCATGCATGTACTGGGTTCCGGCGAC
GCTTACCAGCTGGCAGGAATCGTGTCCTGGGGCGAAGGATGTGCCAAGCC
GAATGCCCCGGGCGTTTATACACGAGTGGGCAGCTTCAATGATTGGATTG
CGGAGAACACCAGGGATGCCTGCTCCTGTGCCCAACCAGAAGCTGCTGGG
GAACCAGCTTCCCCTATGGAAACCACCGAGCAGGGAGACCAAGAGAACAC
CACTGCAAATGGAGCAGCAGAAGCAGATCCCGAGGTGGAGGAGGCCAATA
AGTTGATTGCAAGCTTTCTAGACCAT

BO29108.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-RA 1095 CG18735-PA 1..1092 17..1108 5460 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-RA 1179 CG18735-RA 29..1121 16..1108 5465 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21798075..21799167 1108..16 5465 100 Minus
Blast to na_te.dros performed 2014-11-27 07:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Doc2-element 4789 Doc2-element DOC2 4789bp 1358..1426 97..29 120 63.8 Minus

BO29108.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:00:05 Download gff for BO29108.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1092 17..1110 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:00 Download gff for BO29108.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 30..1121 17..1110 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:48 Download gff for BO29108.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 30..1121 17..1110 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:48 Download gff for BO29108.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21798072..21799166 17..1110 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:00 Download gff for BO29108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17685577..17686671 17..1110 99   Minus

BO29108.pep Sequence

Translation from 16 to 1126

> BO29108.pep
MCNFHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQ
SILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML
MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIV
DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA
GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMI
CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGV
YTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGA
AEADPEVEEANKLIASFLDH

BO29108.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-PA 364 CG18735-PA 1..364 1..364 1957 100 Plus
CG4386-PA 372 CG4386-PA 53..366 22..323 893 54.1 Plus
CG9294-PB 352 CG9294-PB 82..344 64..321 739 51.7 Plus
CG4914-PA 374 CG4914-PA 83..370 36..321 654 46 Plus
CG3355-PA 314 CG3355-PA 43..312 58..321 630 47.1 Plus