Clone BO29111 Report

Search the DGRC for BO29111

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG6901-RA
Protein status:BO29111.pep: Imported from assembly
Sequenced Size:1498

Clone Sequence Records

BO29111.complete Sequence

1498 bp assembled on 2011-08-26

GenBank Submission: KX795128

> BO29111.complete
GAAGTTATCAGTCGACATGAGTGGTATGCAAACCACAACTGTGGACCCAG
TACCCAGCCCCCCACAGGAAACCATCATCATCGCCACCGCGCCACCACCT
GAGCCCAGAAAACCGGCTGTGACCACTAATAACCGAGGATACTTTACCCG
CATCAATAAACAGAATTATGCGTCCTATACAGTTTTCTTCCTATTCATCT
ATGGTGGCATGGACATGGCAGCCAGCTTGGGCTGGAGTCAACCCTACAGC
GTCCTCCTATTCACGGAGTACTCGTACTGTTGGTTTGTAGGTGTCATCAT
TGGAGCGCTGGCCACCACTCTCACCATGTCTTTTCTGCCCAAGCTGGTCT
ACTATGTTTTTGGTGCTCTTATGCAACTAACTGGATCCATTATATTTACG
GCTGCAGACTATTCCGCCTGCCTGGCGGCCCGCTATTTGGCCGGGTTAGG
GATTGGCCTCATTACGGTGCCATTCCTCATTCACAATGCTGAGGTGGCAT
CTAACAACTTACGAGGAGTCAACGGCGGAATGGAGCAGTGCGGTCTAGCC
CTCGGAATTTTCTTTCAAGTGATTTTTACTACGGAGTGGACTTCATTAAT
TGACTCAAACCCAAACGAGATCCATGGCATCATAGGGATCGTCGTCTCAT
TGTTTGGTTTGGCGATGACTGCCCTGGTGGTAGAGTCGCCAATCTTCTTT
CTACGTCGAAATATGGAGAACAGGGCGCAGCAGAGTCAGGAGAAACTTTT
GAGACATAATCCCGGTGGCGTTAGTGCAGCTCTGAAGGAGGCCAGAAGGT
ATGTGGCGGAGAGCGACAACCGGACCCTGGGGGAGGAACTGGTGGCCTCG
GTGATGCCCTTCTTGAAAATGCTACTCTTTCGCTGCTTCGTGGCATTCTC
CTTCTCTCTGCCGCTGACCATGTCGATCATCTCGAGCACCGCAGTAGCGG
AGAAAGGACTCAGTCTTTGGCCAATCTACCTATTTGGCGTTCTTCGTGTG
ATTGGAGTAATGGTGGCTTTGATATTCCTGGACACTTTGGGTCGCAAGGC
GGTGTCCTTGGTGGGCCTCCTTGTTATGGCCGGACTAATGCTCGGATTGG
CGGGTCTATATGCCAACGTGACCAACTTAATTAGCTTTAACTTAATGACC
TCAGCCTGCAATATCGCATTGGCCTTCCAGGTATTCGCAGGTCTCTTCGT
GTGCAGCTCATCCGCATACATGGGCGAGGCTTTTCCCATGCGGGTCAAGT
CGTTCCTGGTCGGAGTGATTGTCATCATTGAGCAGATCGTCCATATCGTG
GTAATTGCCTGTGTAAGCTCTGTGCCCAACAAGGACTTCTTCTTCCAGTA
TTTTTTGGCCGTAGGCATTATAATGCTGGTGGGCATGATCTTCTTTACCG
TGTCTATGCCGGAGACAAAGAAGATGACGCTGAGGAAGGCTGGCCACCGT
TTTCAGAAGTGGTACGACGTACAGATGTACGCAAGCTTTCTAGACCAT

BO29111.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-RA 1458 CG6901-PA 1..1455 26..1480 7275 100 Plus
CG17929-RB 1476 CG17929-PB 1166..1235 1170..1239 215 87.1 Plus
CG17930-RA 1509 CG17930-PA 1202..1272 1170..1240 190 84.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-RA 1581 CG6901-RA 40..1503 17..1480 7320 100 Plus
CG17929-RB 1670 CG17929-RB 1247..1316 1170..1239 215 87.1 Plus
CG17930-RA 1653 CG17930-RA 1296..1366 1170..1240 190 84.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16323926..16325050 356..1480 5625 100 Plus
3R 32079331 3R 16323677..16323854 180..357 890 100 Plus
3R 32079331 3R 16323454..16323619 17..182 830 100 Plus
3R 32079331 3R 16326908..16326977 1170..1239 215 87.1 Plus
3R 32079331 3R 16329265..16329335 1170..1240 190 84.5 Plus
Blast to na_te.dros performed on 2014-11-26 22:11:56 has no hits.

BO29111.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:10 Download gff for BO29111.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1455 26..1482 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:50:03 Download gff for BO29111.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 40..1503 17..1482 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:54:01 Download gff for BO29111.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 40..1503 17..1482 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:54:01 Download gff for BO29111.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16323926..16325050 356..1482 99   Plus
3R 16323680..16323852 183..355 100 -> Plus
3R 16323454..16323619 17..182 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:50:03 Download gff for BO29111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12149648..12150772 356..1482 99   Plus
arm_3R 12149402..12149574 183..355 100 -> Plus
arm_3R 12149176..12149341 17..182 100 -> Plus

BO29111.pep Sequence

Translation from 16 to 1498

> BO29111.pep
MSGMQTTTVDPVPSPPQETIIIATAPPPEPRKPAVTTNNRGYFTRINKQN
YASYTVFFLFIYGGMDMAASLGWSQPYSVLLFTEYSYCWFVGVIIGALAT
TLTMSFLPKLVYYVFGALMQLTGSIIFTAADYSACLAARYLAGLGIGLIT
VPFLIHNAEVASNNLRGVNGGMEQCGLALGIFFQVIFTTEWTSLIDSNPN
EIHGIIGIVVSLFGLAMTALVVESPIFFLRRNMENRAQQSQEKLLRHNPG
GVSAALKEARRYVAESDNRTLGEELVASVMPFLKMLLFRCFVAFSFSLPL
TMSIISSTAVAEKGLSLWPIYLFGVLRVIGVMVALIFLDTLGRKAVSLVG
LLVMAGLMLGLAGLYANVTNLISFNLMTSACNIALAFQVFAGLFVCSSSA
YMGEAFPMRVKSFLVGVIVIIEQIVHIVVIACVSSVPNKDFFFQYFLAVG
IIMLVGMIFFTVSMPETKKMTLRKAGHRFQKWYDVQMYASFLDH

BO29111.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-PA 485 CG6901-PA 1..485 4..488 2461 100 Plus
CG17929-PB 491 CG17929-PB 7..491 8..488 1197 51.1 Plus
CG17930-PA 502 CG17930-PA 1..502 4..488 1163 46.6 Plus
CG42826-PA 473 CG42826-PA 8..470 26..484 501 28.8 Plus
CG32054-PA 563 CG32054-PA 91..558 16..482 466 29.4 Plus