Clone BO29116 Report

Search the DGRC for BO29116

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptCG10237-RC
Protein status:BO29116.pep: Imported from assembly
Sequenced Size:987

Clone Sequence Records

BO29116.complete Sequence

987 bp assembled on 2011-08-26

> BO29116.complete
GAAGTTATCAGTCGACATGAGAGTACCCACCATGCTGTCGGACATCGACC
AACTGCCCACGCTCCAGGTGGGCGACTACACGCTCCAGTTCGAGTTGGGC
GAGCCGACTGCCCAGGGCAAGGAGGTGGCCATCAAGGAGCTGCGCGAAAC
ACCCGAGCGCCAGAAGGAGGCCTCCAAGGAGCTGGCCCGTCTTCTAGAAG
CGGAGACGGACTTGCTGTACCCCAAGGGAAACGAGGAGTGGCTGATCAGA
TACCTGCGGCCCTGCAAGTATTACCCGGAAAGTGCCCGTGATCTGATTAA
GCGGTACTACGCCTTCAAGGTGAAGCACGCGGATGTGTACACCGACCTGA
AGCCATCGAACGAGGCCAACATCTTCAAGCACAACATCCTTACCGTCTTC
CCCAACCGAGATCAACTGGGTCGTCGCATTTTGGTCCTCGAACTGGGCAA
GCGCTGGAAGCACAAGCAGGTCACCCTCGATGAGGTGTTCAAGGGAGCTG
TGCTCTTCCTGGAGGCGGCCATGCTGGAGCCAGAAACACAGATCTGCGGA
GCCGTTGTGATCTTCGACATGGATGGCCTCAGTCTCCAGCAAACGTGGCA
GTTTACGCCTCCGTTCGCCAAGCGCATTGTGGACTGGCTTCAGGACTCGG
TGCCGCTCCGGATCAAGGCCATTCACATCGTGAACCAGCCGAAGATTTTC
CAGGTGGTCTTTGCCCTGTTCAAGCCCTTCCTCAAGGAGAAGCTGCGCAG
CAGGATCATCTTCCATGGCACCGATCGCGAGTCCCTGCACAAATACATGT
CGCCCAAGTGCCTGCCAGCCGCATACGGAGGATTCCGGGAGGCCAGCCGC
ATCGACAGCGACCAGTGGTACCAGCTGCTGCTCAAGTGCGACACCGAGTT
CGACACCATCAACTCGTACGGCTACAAGAAGAAGGCCAAGCTTTCTAGAC
CAATTTGTTGGGCGGCGGGGGAGGGGGGGGAGGGGGT

BO29116.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-RE 921 CG10237-PE 1..918 17..934 4575 99.9 Plus
CG10237-RC 921 CG10237-PC 1..918 17..934 4575 99.9 Plus
CG10237-RB 975 CG10237-PB 59..972 21..934 4555 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-RE 2011 CG10237-RE 795..1712 17..934 4575 99.9 Plus
CG10237-RC 1418 CG10237-RC 202..1119 17..934 4575 99.9 Plus
CG10237-RD 1720 CG10237-RD 508..1421 21..934 4555 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19436149..19436633 934..450 2410 99.8 Minus
2L 23513712 2L 19437666..19437845 200..21 900 100 Minus
2L 23513712 2L 19436810..19436964 449..295 775 100 Minus
2L 23513712 2L 19437032..19437128 295..199 485 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:13:06 has no hits.

BO29116.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:13 Download gff for BO29116.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 200..1117 17..934 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:50:45 Download gff for BO29116.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 202..1119 17..934 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:54:34 Download gff for BO29116.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 202..1119 17..934 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:54:34 Download gff for BO29116.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19437666..19437847 17..200 98   Minus
2L 19437032..19437126 201..295 100 <- Minus
2L 19436810..19436963 296..449 100 <- Minus
2L 19436143..19436633 450..941 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:50:45 Download gff for BO29116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19437666..19437847 17..200 98   Minus
arm_2L 19437032..19437126 201..295 100 <- Minus
arm_2L 19436810..19436963 296..449 100 <- Minus
arm_2L 19436143..19436633 450..941 98 <- Minus

BO29116.pep Sequence

Translation from 16 to 985

> BO29116.pep
MRVPTMLSDIDQLPTLQVGDYTLQFELGEPTAQGKEVAIKELRETPERQK
EASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIKRYYAF
KVKHADVYTDLKPSNEANIFKHNILTVFPNRDQLGRRILVLELGKRWKHK
QVTLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPPF
AKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFH
GTDRESLHKYMSPKCLPAAYGGFREASRIDSDQWYQLLLKCDTEFDTINS
YGYKKKAKLSRPICWAAGEGGEG

BO29116.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-PE 306 CG10237-PE 1..306 1..306 1606 100 Plus
CG10237-PC 306 CG10237-PC 1..306 1..306 1606 100 Plus
CG10237-PB 324 CG10237-PB 21..324 3..306 1596 100 Plus
CG10237-PD 301 CG10237-PD 1..301 6..306 1580 100 Plus
CG10237-PA 301 CG10237-PA 1..301 6..306 1580 100 Plus