Clone BO29119 Report

Search the DGRC for BO29119

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG11596-RC
Protein status:BO29119.pep: Imported from assembly
Sequenced Size:1402

Clone Sequence Records

BO29119.complete Sequence

1402 bp assembled on 2011-08-26

GenBank Submission: KX794225

> BO29119.complete
GAAGTTATCAGTCGACATGAGCTCCATGGACTGCGCCACGTTCCCAATGC
ATCCTAAAATGGACGAGCAACTGGCCCGAACCTTCGTCATCAACGAGGAG
GAGGAGGAGAAGCACATTCAGAAGGTGCAGAACGCCTTCCTTTACTATGG
GCCATATGCGTGTCAGCGGCTAAAGCGCTCCATGGATTACCTGAACAGCC
TGTCTGGCGAGGACCAAATCATGCTAGCCAAGTACCGAGGGCATCTGGAG
TGCGTGCGCACGTGCATCGATCGCAACCAGGCGGTTATCCGGGAAATATT
GCGCGGGCGTGTCCTCTATCCGACGGATGAGGCGACTGGTGATCCCTCGG
AGTTTGACGAGCCGCCGCCAAATGTGCGGCACGGTGACATGGACCAGATT
GATATTCCATTCGATGAAGCTGACGTTGAACCTCTAAAAATTTTAAAGGC
CCAGTCGACGTTGAAGTTGATTGCGCGCGACTGGAGCACTGAAGGAGCCT
TAGAACGGGAGCAATCGTATAAACCGATCATCGACAGCATCGTTGCGTAC
TTCAAGCACAGCGATTTCGAGCTGAAGGATATAAAGATCCTAGTGCCGGG
AGCGGGGTTGGGACGGCTCACCTACGAGCTTGCCTGCTTGGGGTACTCGT
GCGAGGGCAACGAGTTTTCCTACTTCATGCTGATCGCCTCCAATTTTGTC
CTCAACCTCTGCGACAACGAGAACAAGTACGTGTTATATCCGTGGGTGCA
CCAGTATGTGAATAACTTAAGGCGTGAGGATCAGGTGGCCCCCGTTCGTT
TCCCAGACGTCTGCCCGCTTAAAAATCCACCCAAGGGCCATTTTGAAATA
GCAGCTGGCGACTTTCTGGAGGTCTACAAGACGCCGAACGCCTACAACTG
CGTGGCTACGTGCTTCTTCATCGATTGTGCCAATAATGTTATTGACTTCA
TACGCACAATTTACAAAATCCTCGTGCCTGGTGGCATTTGGGTGAATCTC
GGGCCGCTGCTGTACCATTTTAGCGACGTCAGCGGGCAAAACAGCATCGA
GCCGGCTTTCGAGGACCTTTGCATTATCATGGAAAGCGTAGGATTCGTTA
TCGAGAAATCACGCACCGGCATCCGTACCAAGTACGCACAGAACCCGTCT
TCAATGAAACAGAGCGAGTACCAGAGTCTTTTCTGGGTCTGCCGCAAGCC
GGATCTATTTGAGGAGCAGCGGGGCAAACGCAAGGCCTCCAGGGAGCCAC
ACGATCTTATTGTGCGCGAGGACAGCGAGGAGGAGGGGGAGCAACAGCCG
GAACGAAATGAAACGGAAGAAAAACAGCAACTGAAACCGCTGGCCACAGC
CAACTGCGAGACTGAGATAAAGGAGCAGCCATCGGCAAGCTTTCTAGACC
AT

BO29119.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-RC 1371 CG11596-PC 1..1368 17..1384 6840 100 Plus
CG11596-RE 1206 CG11596-PE 1..1203 182..1384 6015 100 Plus
CG11596-RD 1206 CG11596-PD 1..1203 182..1384 6015 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-RC 1791 CG11596-RC 104..1471 17..1384 6840 100 Plus
CG11596-RE 1765 CG11596-RE 211..1445 150..1384 6175 100 Plus
CG11596-RB 1648 CG11596-RB 95..1328 151..1384 6170 100 Plus
CG11596-RE 1765 CG11596-RE 104..212 17..125 545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1929773..1930190 967..1384 2090 100 Plus
X 23542271 X 1929454..1929711 709..966 1290 100 Plus
X 23542271 X 1928333..1928580 150..397 1240 100 Plus
X 23542271 X 1928998..1929170 395..567 865 100 Plus
X 23542271 X 1929244..1929384 568..708 705 100 Plus
X 23542271 X 1927786..1927920 17..151 675 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:27:17 has no hits.

BO29119.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:36 Download gff for BO29119.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 107..1474 17..1386 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:58:40 Download gff for BO29119.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 104..1471 17..1386 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:01:36 Download gff for BO29119.complete
Subject Subject Range Query Range Percent Splice Strand
CG11596-RC 104..1471 17..1386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:01:36 Download gff for BO29119.complete
Subject Subject Range Query Range Percent Splice Strand
X 1929773..1930190 967..1386 99   Plus
X 1929454..1929711 709..966 100 -> Plus
X 1929244..1929384 568..708 100 -> Plus
X 1929001..1929170 398..567 100 -> Plus
X 1928334..1928580 151..397 100 -> Plus
X 1927786..1927919 17..150 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:58:40 Download gff for BO29119.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1823806..1824223 967..1386 99   Plus
arm_X 1823487..1823744 709..966 100 -> Plus
arm_X 1823277..1823417 568..708 100 -> Plus
arm_X 1823034..1823203 398..567 100 -> Plus
arm_X 1822367..1822613 151..397 100 -> Plus
arm_X 1821819..1821952 17..150 100 -> Plus

BO29119.pep Sequence

Translation from 16 to 1402

> BO29119.pep
MSSMDCATFPMHPKMDEQLARTFVINEEEEEKHIQKVQNAFLYYGPYACQ
RLKRSMDYLNSLSGEDQIMLAKYRGHLECVRTCIDRNQAVIREILRGRVL
YPTDEATGDPSEFDEPPPNVRHGDMDQIDIPFDEADVEPLKILKAQSTLK
LIARDWSTEGALEREQSYKPIIDSIVAYFKHSDFELKDIKILVPGAGLGR
LTYELACLGYSCEGNEFSYFMLIASNFVLNLCDNENKYVLYPWVHQYVNN
LRREDQVAPVRFPDVCPLKNPPKGHFEIAAGDFLEVYKTPNAYNCVATCF
FIDCANNVIDFIRTIYKILVPGGIWVNLGPLLYHFSDVSGQNSIEPAFED
LCIIMESVGFVIEKSRTGIRTKYAQNPSSMKQSEYQSLFWVCRKPDLFEE
QRGKRKASREPHDLIVREDSEEEGEQQPERNETEEKQQLKPLATANCETE
IKEQPSASFLDH

BO29119.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11596-PC 456 CG11596-PC 1..456 1..456 2431 100 Plus
CG11596-PA 439 CG11596-PA 1..439 1..456 2317 96.3 Plus
CG11596-PE 401 CG11596-PE 1..401 56..456 2136 100 Plus
CG11596-PD 401 CG11596-PD 1..401 56..456 2136 100 Plus
CG11596-PB 401 CG11596-PB 1..401 56..456 2136 100 Plus