Clone BO29121 Report

Search the DGRC for BO29121

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptwupA-RB
Protein status:BO29121.pep: Imported from assembly
Sequenced Size:658

Clone Sequence Records

BO29121.complete Sequence

658 bp assembled on 2011-08-26

GenBank Submission: KX796095

> BO29121.complete
GAAGTTATCAGTCGACATGGCTGATGATGAGGCTAAGAAGGCTAAACAGG
CTGAGATCGAGCGCAAGCGTGCTGAGGTGCGCAAGCGCATGGAGGAAGCC
TCCAAGGCCAAGAAGGCCAAGAAGGGTTTCATGACCCCAGAGAGGAAGAA
GAAACTCAGGTTGCTGCTGCGTAAGAAAGCCGCTGAGGAGCTGAAGAAAG
AACAGGAACGCAAAGCGGCTGAACGTAGACGCATCATCGAAGAACGTTGC
GGCAGTCCCAGGAATCTCAGCGATGCCAGCGAAGATACTATTCAGAGTGT
TTGTAAGGACTACCACAGTAAGATACTGAAACTGGAGTCCGAAAAGTACG
ATTTCGAGTACGATGTAGCCAGAAAGGATTATGAGATCAACGATCTCAAT
GCCCAAGTTAACGATCTTCGCGGCAAGTTCGTCAAGCCAGCCCTGAAGAA
GGTCTCCAAATACGAAAACAAATTCGCCAAGCTGCAGAAGAAGGCCGCTG
AGTTCAACTTCCGCAACCAGCTCAAGGTGGTGAAGAAGAAGGAGTTCACG
CTGGAGGAGGAGGAGAAGGAGAAGAAACCCGACTGGTCCAAGGGCAAGCC
CGGAGATGCCAAGGTGAAGGAGGAGGTTGAGGCCGAAGCTGCAAGCTTTC
TAGACCAT

BO29121.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-RB 627 CG7178-PB 1..624 17..640 3120 100 Plus
wupA-RA 627 CG7178-PA 1..624 17..640 2445 92.8 Plus
wupA-RJ 600 CG7178-PJ 1..557 17..573 2110 91.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-RB 1160 CG7178-RB 141..764 17..640 3120 100 Plus
wupA-RA 1160 CG7178-RA 141..764 17..640 2445 92.8 Plus
wupA-RL 1345 CG7178-RL 345..949 36..640 2350 92.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18106681..18106822 571..430 710 100 Minus
X 23542271 X 18113447..18113577 160..30 655 100 Minus
X 23542271 X 18113258..18113382 284..160 625 100 Minus
X 23542271 X 18111938..18112040 385..283 515 100 Minus
X 23542271 X 18105964..18106034 640..570 355 100 Minus
X 23542271 X 18106888..18106933 429..384 230 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:28:06 has no hits.

BO29121.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:37 Download gff for BO29121.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 138..761 17..642 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:59:09 Download gff for BO29121.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 141..764 17..642 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:01:59 Download gff for BO29121.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 141..764 17..642 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:01:59 Download gff for BO29121.complete
Subject Subject Range Query Range Percent Splice Strand
X 18113447..18113575 32..160 100 <- Minus
X 18113258..18113381 161..284 100 <- Minus
X 18111938..18112038 285..385 100 <- Minus
X 18106888..18106931 386..429 100 <- Minus
X 18106681..18106822 430..571 100 <- Minus
X 18105962..18106032 572..642 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:59:09 Download gff for BO29121.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18007480..18007608 32..160 100 <- Minus
arm_X 18007291..18007414 161..284 100 <- Minus
arm_X 18005971..18006071 285..385 100 <- Minus
arm_X 18000921..18000964 386..429 100 <- Minus
arm_X 18000714..18000855 430..571 100 <- Minus
arm_X 17999995..18000065 572..642 97 <- Minus

BO29121.pep Sequence

Translation from 16 to 658

> BO29121.pep
MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLL
LRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEDTIQSVCKDYH
SKILKLESEKYDFEYDVARKDYEINDLNAQVNDLRGKFVKPALKKVSKYE
NKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKV
KEEVEAEAASFLDH

BO29121.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PB 208 CG7178-PB 1..208 1..208 1047 100 Plus
wupA-PA 208 CG7178-PA 1..208 1..208 962 92.3 Plus
wupA-PF 208 CG7178-PF 1..208 1..208 950 89.4 Plus
wupA-PC 208 CG7178-PC 1..208 1..208 950 89.4 Plus
wupA-PE 208 CG7178-PE 1..208 1..208 927 88.9 Plus