Clone BO29125 Report

Search the DGRC for BO29125

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG9293-RB
Protein status:BO29125.pep: Imported from assembly
Sequenced Size:847

Clone Sequence Records

BO29125.complete Sequence

847 bp assembled on 2011-08-26

GenBank Submission: KX797601

> BO29125.complete
GAAGTTATCAGTCGACATGTCATCGGCTATATACCTAGAGAACTATTTAG
ACGGATTGGAAAGTCTGCCAACGGAGCTGGAGAGAAATTTTAAGCTGATG
CGAAAATTAGACGATCGAGCACAAACAGCGATGAAGAGCATCGATAGCCA
TGCCAAGGACTTTATGCGCAAGCTGGGCGAGAACGGGGCCATGAGCGAGG
ATGAGAGGAGGGAGCGCCAGGAGGATATCAAGGCACTGTTCGGAAAGGCC
AAGGAGTACAGCGACGACAAGGTGCAGCTGGCCATTCAGACCTACGAACT
AGTGGACAAGCAGATACGGCGACTGGACAACGATTTAGCACGCTTCGAGG
GTGAGATTCAGGAGAAGGCCTCATCCACGCGTGCCAAATCCGAGGAAGTG
GTGGCCAAGAAAGGTCGCAAAAAAACCAAGGACAGCAAGACGACGGGCAA
AAAGAAAAAGTCCGCATCCTCGGATGAGGAAACTGGGCGCGGCAACAACC
AATCTAACGCCAATTCCAGTGTCAATTCGAGCAGCAATGCCGGGCAAGGT
AGCAAAAAGAAAAAGTCCAAGAAAACCGTCGAGGTTGATGACTCTGAGAA
GGAATCGTGCCACACGGCCGCCACTCATCCCAGCGACGTTATGGACATGC
CCGTCGATCCCAATGAGCCCACATATTGCCTATGCCACCAGGTGTCCTAT
GGAGAGATGATTGGCTGCGACAATCCCGACTGTCCCATCGAGTGGTTTCA
CTTCGCTTGTGTTGGCCTCACCACAAAGCCAAAGGGCAAGTGGTTCTGTC
CCAAGTGCACGCAGGACAGAAAGAAGAAAGCAAGCTTTCTAGACCAT

BO29125.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-RB 816 CG9293-PB 1..813 17..829 4050 99.9 Plus
CG9293-RA 858 CG9293-PA 1..555 17..571 2775 100 Plus
CG9293-RA 858 CG9293-PA 595..855 569..829 1290 99.6 Plus
Ing3-RA 2061 CG6632-PA 1869..2024 655..810 225 76.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-RB 1002 CG9293-RB 100..912 17..829 4050 99.9 Plus
CG9293-RA 1044 CG9293-RA 100..654 17..571 2775 100 Plus
CG9293-RA 1044 CG9293-RA 694..954 569..829 1290 99.6 Plus
Ing3-RA 2298 CG6632-RA 1997..2152 655..810 225 76.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13386757..13387114 410..53 1790 100 Minus
2L 23513712 2L 13386099..13386259 730..570 805 100 Minus
2L 23513712 2L 13386530..13386690 571..411 805 100 Minus
2L 23513712 2L 13385938..13386036 829..731 480 99 Minus
X 23542271 X 18650864..18651019 810..655 225 76.3 Minus
2L 23513712 2L 13387176..13387213 54..17 190 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:28:58 has no hits.

BO29125.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:39 Download gff for BO29125.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 87..889 17..819 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:59:36 Download gff for BO29125.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 100..902 17..819 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:26 Download gff for BO29125.complete
Subject Subject Range Query Range Percent Splice Strand
CG9293-RB 100..902 17..819 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:26 Download gff for BO29125.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13387177..13387213 17..53 100   Minus
2L 13386757..13387113 54..410 100 <- Minus
2L 13386530..13386690 411..571 100 <- Minus
2L 13386099..13386257 572..730 100 <- Minus
2L 13385948..13386036 731..819 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:59:36 Download gff for BO29125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13387177..13387213 17..53 100   Minus
arm_2L 13386757..13387113 54..410 100 <- Minus
arm_2L 13386530..13386690 411..571 100 <- Minus
arm_2L 13386099..13386257 572..730 100 <- Minus
arm_2L 13385948..13386036 731..819 98 <- Minus

BO29125.pep Sequence

Translation from 16 to 847

> BO29125.pep
MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFM
RKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQI
RRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRKKTKDSKTTGKKKKSA
SSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKKTVEVDDSEKESCHT
AATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVG
LTTKPKGKWFCPKCTQDRKKKASFLDH

BO29125.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9293-PB 271 CG9293-PB 1..271 1..271 1422 100 Plus
CG9293-PA 285 CG9293-PA 1..285 1..271 1397 95.1 Plus
CG7379-PA 433 CG7379-PA 223..419 112..275 292 34.8 Plus
Ing3-PA 686 CG6632-PA 624..683 214..273 257 61.7 Plus
Ing3-PA 686 CG6632-PA 2..169 5..179 198 30.9 Plus
MESR4-PD 2151 CG4903-PD 2092..2136 220..264 163 55.6 Plus