Clone BO29129 Report

Search the DGRC for BO29129

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptMAPk-Ak2-RB
Protein status:BO29129.pep: Imported from assembly
Sequenced Size:1111

Clone Sequence Records

BO29129.complete Sequence

1111 bp assembled on 2011-08-26

GenBank Submission: KX794442

> BO29129.complete
GAAGTTATCAGTCGACATGCTTTCTCTGCAGAATCAACGGCAACCGAAGA
CCACCCCACTGACGGACGACTACGTGACCTCGAACACGGTTCTGGGCTAC
GGGATCAACGGGAAGGTGGTGCAGTGCACCCATCGCCGCACCCAACAGAA
CTATGCCCTCAAGGTGCTGTTGGACAGTGAAAGGGCGCGTCGCGAAGTGG
ACCTGCATTGGCGGGTCAGCGGATGCCGGTACATTGTGAACATCATTGAT
GTGTACGAGAACACGTTTAAGGACAGGAAGTGCCTCCTGGTGGTCATGGA
GTGCATGGAGGGCGGCGAGCTCTTCCAGAGAATTCAGGACAAGGCCGACG
GTGCCTTTACGGAGCGGGAGGCGGCCCAGATAATGCACGAGATCTGCGCG
GCCGTAGACTATCTGCACAGTCGCGACATAGCGCATCGCGATCTCAAGCC
GGAGAACTTGCTGTACACCACCACTCAGCCGAATGCGACCCTTAAATTGA
CGGACTTTGGCTTCGCCAAGGAGACATTCACCAGTTACACGCTGCAGACG
CCCTGCTACACTCCCTATTACGTGGCTCCTGAGGTTCTGGGCCCGGAGAA
GTACGACAAGAGCTGCGACATCTGGTCGCTGGGCGTGGTGATGTACATCA
TTATGTGCGGATTCCCGCCGTTCTACAGCAACCACGGCCTAGCCATATCG
CCCGGCATGAAAAATCGCATCCGCACCGGCCAGTATGACTTTCCCGATCC
GGAGTGGACGAATGTGAGCCAGGCGGCAAAGGATCTGATCAAGGGCATGC
TGAACGTGGACCCCAGCAAGCGTCTGCGCATCCAGGACGTCATTAGCAAC
AAGTGGATTGCCCAGTACAATGCTGTTCCACAGACACCGCTCTGCACGGG
TCGCATGCTAAAGGAGGCCGAGGAAACCTGGCCGGAAGTGCAGGAGGAGA
TGACGCGCTCACTGGCCACCATGCGCGTAGACTACGATCAGATGCAAATC
AAGGCGCTGGACAAGTCGAACAACCCGCTGCTGACGAAGCGCAGGAAAAA
GATCGAGGAGATGGAGTTATACATGGCCAATGCGACGCGCAACGCAAGCT
TTCTAGACCAT

BO29129.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-RF 1080 CG3086-PF 1..1077 17..1093 5385 100 Plus
MAPk-Ak2-RE 1080 CG3086-PE 1..1077 17..1093 5385 100 Plus
MAPk-Ak2-RD 1080 CG3086-PD 1..1077 17..1093 5385 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-RF 1913 CG3086-RF 26..1102 17..1093 5385 100 Plus
MAPk-Ak2-RE 2060 CG3086-RE 173..1249 17..1093 5385 100 Plus
MAPk-Ak2-RD 2045 CG3086-RD 158..1234 17..1093 5385 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5762101..5762659 575..17 2795 100 Minus
X 23542271 X 5761169..5761585 991..575 2085 100 Minus
X 23542271 X 5760719..5760823 1093..989 525 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:29:16 has no hits.

BO29129.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:39 Download gff for BO29129.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RD 153..1229 17..1095 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:59:46 Download gff for BO29129.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RB 133..1209 17..1095 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:35 Download gff for BO29129.complete
Subject Subject Range Query Range Percent Splice Strand
MAPk-Ak2-RD 158..1234 17..1095 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:35 Download gff for BO29129.complete
Subject Subject Range Query Range Percent Splice Strand
X 5762101..5762659 17..575 100   Minus
X 5761169..5761584 576..991 100 <- Minus
X 5760717..5760820 992..1095 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:59:46 Download gff for BO29129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5656134..5656692 17..575 100   Minus
arm_X 5655202..5655617 576..991 100 <- Minus
arm_X 5654750..5654853 992..1095 98 <- Minus

BO29129.pep Sequence

Translation from 16 to 1111

> BO29129.pep
MLSLQNQRQPKTTPLTDDYVTSNTVLGYGINGKVVQCTHRRTQQNYALKV
LLDSERARREVDLHWRVSGCRYIVNIIDVYENTFKDRKCLLVVMECMEGG
ELFQRIQDKADGAFTEREAAQIMHEICAAVDYLHSRDIAHRDLKPENLLY
TTTQPNATLKLTDFGFAKETFTSYTLQTPCYTPYYVAPEVLGPEKYDKSC
DIWSLGVVMYIIMCGFPPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNV
SQAAKDLIKGMLNVDPSKRLRIQDVISNKWIAQYNAVPQTPLCTGRMLKE
AEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEEME
LYMANATRNASFLDH

BO29129.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
MAPk-Ak2-PF 359 CG3086-PF 1..359 1..359 1907 100 Plus
MAPk-Ak2-PE 359 CG3086-PE 1..359 1..359 1907 100 Plus
MAPk-Ak2-PD 359 CG3086-PD 1..359 1..359 1907 100 Plus
MAPk-Ak2-PB 359 CG3086-PB 1..359 1..359 1907 100 Plus
CaMKI-PI 390 CG1495-PI 56..337 44..336 445 33.2 Plus