Clone BO29131 Report

Search the DGRC for BO29131

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptSdc-RD
Protein status:BO29131.pep: Imported from assembly
Sequenced Size:1228

Clone Sequence Records

BO29131.complete Sequence

1228 bp assembled on 2011-08-26

GenBank Submission: KX795581

> BO29131.complete
GAAGTTATCAGTCGACATGAAGCCAAAGCAGAAGATTTCCGTAGAGCCGC
TATTGCTAGTCGCAATTCTCATCGGAGTTCTGGTAGCCGCCACCCACGCT
CAAGATCAGAAATCGGTGAAACCATCGGCGGCAGCGCCATCAGCAGCAGC
TTCTCGGCCCCATGATGAAATCTATATCGACGATGATAGCATCGAGGGAT
CCGGCGGACGCGGCGGTATACACGAAGATCTAGAGAAAGATCCGGACTAT
TCTGGCTCCGGCTTTGGACCCGATGACGAGGACGCCGAACCCGATCAGCA
TTCGCACAGTTCGCACAACACGCGCATCTCGCAGAGCAGCAACTCCGGCA
TAAACACTCATACACCAACACAAACCTCATCCACAATCCCAACAACATCG
ACTTCGACACCAATGCCGACAACAACCCCCACAGCGACAACCCCCGCATC
CACCACAACGGCGGCAGCAACCCAGATATCGTCCTTTGCCAATAGCAGTA
GCACCACCACCACCACGTTGGCTCCCACGATTCCCGCAGAACCGCAGCAA
CCGCTGTTCCCGCCATTCGACAAGGATCTGGATACGGAGTCCAGCGGCGA
TGGCATCGATGCTGATGCTGAGGATGACGATGAGGACGATGGCGACGATA
AGGACTATGACTATAACAAGGAGCTGGACAAAGAAATCGACATCGATGGT
CCCGAGCCGGGACATCTGCCGCCAGTTGTCCATCATAATACCGTTGAAAC
TGGTCACATACCCACTACGGATGAAATCGATGTGGATGGCGGCGATGAGG
ATGACAATGGGGATAGCGACATCGATGGTCCGCGGATCGGTGGCAACGAT
GGAGATATTACAGAGCGCGGACCGGGTGCAGGTGGCAGCAACGTGCACGA
ATTGGACCCCAATACGAACGTGAATAGCCAGCCCTCCGACACAAAGGGCA
TCGATCACAGGCCCAACGGCAACGAAGTGGTCATCATGAGCGAGGACGAT
CGCACGTCGAGCTTCTTCTCGCAGCCCGGAATTCTGGCTGCTGTCATTGG
CGGTGCCGTCGTTGGCCTGCTCTGCGCCATACTCGTGGTCATGTTCATCG
TGTACCGCATGAGGAAAAAGGACGAGGGATCCTATGCGCTGGACGAGCCA
AAGAGATCGCCGGCCAACAATTCGTATGCGAAAAATGCGAATAACCGCGA
GTTCTACGCCGCAAGCTTTCTAGACCAT

BO29131.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-RD 1197 CG10497-PD 1..1194 17..1210 5970 100 Plus
Sdc-RA 1200 CG10497-PA 1..1197 17..1210 5905 99.7 Plus
Sdc-RJ 1488 CG10497-PJ 632..1485 357..1210 4270 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-RD 1869 CG10497-RD 337..1530 17..1210 5970 100 Plus
Sdc-RA 2482 CG10497-RA 337..1533 17..1210 5905 99.7 Plus
Sdc-RH 2245 CG10497-RH 195..1296 109..1210 5510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21398065..21398580 872..357 2580 100 Minus
2R 25286936 2R 21394566..21394736 1210..1040 855 100 Minus
2R 25286936 2R 21394878..21395045 1040..873 840 100 Minus
2R 25286936 2R 21399175..21399313 356..218 695 100 Minus
2R 25286936 2R 21412311..21412421 217..107 555 100 Minus
2R 25286936 2R 21480091..21480183 109..17 465 100 Minus
Blast to na_te.dros performed 2014-11-26 22:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2374..2533 294..455 173 61.2 Plus
Dfun\Isfun-1 928 Dfun\Isfun-1 DFU309320 928bp Derived from AJ309320 (Rel. 68, Last updated, Version 1). 458..506 1207..1159 110 69.4 Minus

BO29131.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:40 Download gff for BO29131.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 336..1529 17..1212 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:02 Download gff for BO29131.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 337..1530 17..1212 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:47 Download gff for BO29131.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 337..1530 17..1212 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:47 Download gff for BO29131.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21480091..21480183 17..109 100   Minus
2R 21412311..21412418 110..217 100 <- Minus
2R 21399175..21399313 218..356 100 <- Minus
2R 21398065..21398580 357..872 100 <- Minus
2R 21394878..21395045 873..1040 100 <- Minus
2R 21394563..21394735 1041..1212 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:02 Download gff for BO29131.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17367596..17367688 17..109 100   Minus
arm_2R 17299816..17299923 110..217 100 <- Minus
arm_2R 17286680..17286818 218..356 100 <- Minus
arm_2R 17285570..17286085 357..872 100 <- Minus
arm_2R 17282383..17282550 873..1040 100 <- Minus
arm_2R 17282068..17282240 1041..1212 98 <- Minus

BO29131.pep Sequence

Translation from 16 to 1228

> BO29131.pep
MKPKQKISVEPLLLVAILIGVLVAATHAQDQKSVKPSAAAPSAAASRPHD
EIYIDDDSIEGSGGRGGIHEDLEKDPDYSGSGFGPDDEDAEPDQHSHSSH
NTRISQSSNSGINTHTPTQTSSTIPTTSTSTPMPTTTPTATTPASTTTAA
ATQISSFANSSSTTTTTLAPTIPAEPQQPLFPPFDKDLDTESSGDGIDAD
AEDDDEDDGDDKDYDYNKELDKEIDIDGPEPGHLPPVVHHNTVETGHIPT
TDEIDVDGGDEDDNGDSDIDGPRIGGNDGDITERGPGAGGSNVHELDPNT
NVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVIGGAVVG
LLCAILVVMFIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFYAAS
FLDH

BO29131.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-PD 398 CG10497-PD 1..398 1..398 2092 100 Plus
Sdc-PA 399 CG10497-PA 1..399 1..398 2080 99.7 Plus
Sdc-PI 494 CG10497-PI 1..494 1..398 1541 66.2 Plus
Sdc-PJ 495 CG10497-PJ 1..495 1..398 1527 66.3 Plus
Sdc-PH 266 CG10497-PH 1..266 133..398 1411 100 Plus