Clone BO29134 Report

Search the DGRC for BO29134

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:34
Vector:pDNR-Dual
Associated Gene/Transcriptl(1)G0156-RB
Protein status:BO29134.pep: Imported from assembly
Sequenced Size:1165

Clone Sequence Records

BO29134.complete Sequence

1165 bp assembled on 2011-08-26

GenBank Submission: KX798184

> BO29134.complete
GAAGTTATCAGTCGACATGGCTGCTAGATTCATACAGAAAATTCTCAATC
AACTGGGTTTGATTGCAGCGCGTGATGCTCCGGCGGTGACTGCGACGCCA
GCAGTGAGCCAGGTCAACGCGACTCCCGCCGCCAGCCGGTCCTACTCCTC
CGGCACCAAGAAAGTCACCCTCATCCCTGGCGATGGCATCGGACCTGAGA
TCTCTGCGGCCGTGCAGAAAATCTTCACCGCCGCCAATGTCCCCATCGAG
TGGGAGGCCGTGGACGTGACCCCCGTCCGGGGACCCGACGGAAAGTTCGG
CATCCCACAGGCCGCCATTGACTCGGTGAACACGAACAAGATCGGCCTGA
AGGGTCCTCTGATGACGCCCGTCGGCAAGGGCCATCGGTCTCTGAATCTG
GCCCTGCGCAAGGAGTTCAATCTGTACGCCAACGTGCGTCCCTGCCGCAG
TCTCGAGGGCTACAAGACGCTGTACGACGATGTGGACGTGGTCACCATCC
GTGAGAACACCGAGGGCGAGTACTCCGGCATCGAGCACGAGATCGTCGAC
GGCGTCGTTCAGAGCATCAAGCTGATCACCGAGGAAGCCTCCAAGCGTGT
GGCCGAGTACGCCTTCCAGTACGCCAAGAACAACAACCGCAAGAAGGTCA
CCGTGGTGCACAAGGCGAACATTATGCGCATGTCCGATGGTCTCTTCCTG
CGCTGCGTCCGCGACATGGCCCAGAAGTTCCCAGAAATCCAGTTCGAAGA
GAAGTATCTGGATACGGTGTGCCTGAACATGGTCCAGAACCCCGGAAAAT
ACGACGTGCTGGTCATGCCCAATCTGTACGGTGATATTCTGTCTGACATG
TGCGCCGGTTTGGTGGGCGGCCTCGGCCTGACGCCCTCCGGCAACATGGG
CCTGAACGGTGCCCTGTTCGAGTCTGTGCACGGAACCGCCCCCGATATTG
CCGGCAAGGACCTGGCCAATCCCACTGCCCTGTTGCTGTCGGCGGTCATG
ATGCTGCGCCACATGGAGCTCAACACGTACGCCGATAAAATCGAGCGTGC
CGCCTTCGAGACCATCAAGGAGGGCAAATACCTCACCGGCGATCTGGGCG
GCCGTGCCAAGTGCTCCGAGTTCACGAACGAGATCTGTGCCAAGCTGGCA
AGCTTTCTAGACCAT

BO29134.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-RD 1134 CG12233-PD 1..1131 17..1147 5655 100 Plus
l(1)G0156-RC 1065 CG12233-PC 28..1062 113..1147 5175 100 Plus
l(1)G0156-RA 1065 CG12233-PA 28..1062 113..1147 5175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-RD 1395 CG12233-RD 106..1236 17..1147 5655 100 Plus
l(1)G0156-RC 2029 CG12233-RC 133..1167 113..1147 5175 100 Plus
l(1)G0156-RA 1332 CG12233-RA 139..1173 113..1147 5175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19519903..19520299 676..280 1985 100 Minus
X 23542271 X 19519290..19519626 1147..811 1685 100 Minus
X 23542271 X 19520659..19520831 281..109 865 100 Minus
X 23542271 X 19519694..19519831 813..676 690 100 Minus
X 23542271 X 19521326..19521396 114..44 355 100 Minus
3L 28110227 3L 8837967..8838119 473..625 330 81 Plus
3L 28110227 3L 8838311..8838526 799..1014 285 75.5 Plus
Blast to na_te.dros performed on 2014-11-26 22:28:24 has no hits.

BO29134.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:38 Download gff for BO29134.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RB 112..1242 17..1149 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:59:17 Download gff for BO29134.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RD 106..1236 17..1149 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:06 Download gff for BO29134.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RD 106..1236 17..1149 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:06 Download gff for BO29134.complete
Subject Subject Range Query Range Percent Splice Strand
X 19521673..19521699 17..43 100   Minus
X 19521328..19521396 44..112 100 <- Minus
X 19520660..19520827 113..280 100 <- Minus
X 19519904..19520298 281..675 100 <- Minus
X 19519696..19519831 676..811 100 <- Minus
X 19519288..19519625 812..1149 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:59:17 Download gff for BO29134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19415706..19415732 17..43 100   Minus
arm_X 19415361..19415429 44..112 100 <- Minus
arm_X 19414693..19414860 113..280 100 <- Minus
arm_X 19413937..19414331 281..675 100 <- Minus
arm_X 19413729..19413864 676..811 100 <- Minus
arm_X 19413321..19413658 812..1149 99 <- Minus

BO29134.pep Sequence

Translation from 16 to 1165

> BO29134.pep
MAARFIQKILNQLGLIAARDAPAVTATPAVSQVNATPAASRSYSSGTKKV
TLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKFGIPQAA
IDSVNTNKIGLKGPLMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEGYK
TLYDDVDVVTIRENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEYAF
QYAKNNNRKKVTVVHKANIMRMSDGLFLRCVRDMAQKFPEIQFEEKYLDT
VCLNMVQNPGKYDVLVMPNLYGDILSDMCAGLVGGLGLTPSGNMGLNGAL
FESVHGTAPDIAGKDLANPTALLLSAVMMLRHMELNTYADKIERAAFETI
KEGKYLTGDLGGRAKCSEFTNEICAKLASFLDH

BO29134.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-PD 377 CG12233-PD 1..377 1..377 1930 100 Plus
l(1)G0156-PC 354 CG12233-PC 1..354 1..377 1787 93.9 Plus
l(1)G0156-PA 354 CG12233-PA 1..354 1..377 1787 93.9 Plus
CG32026-PA 719 CG32026-PA 353..718 18..377 1146 61.7 Plus
CG6439-PB 370 CG6439-PB 25..370 35..378 727 42.3 Plus