Clone BO29135 Report

Search the DGRC for BO29135

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG1637-RA
Protein status:BO29135.pep: Imported from assembly
Sequenced Size:1393

Clone Sequence Records

BO29135.complete Sequence

1393 bp assembled on 2011-08-26

GenBank Submission: KX797610

> BO29135.complete
GAAGTTATCAGTCGACATGCAGAGACTGCAATTCGCTCTGCTAGCGTCGC
TGCTCCTGCTGGTGCTGCTTCTTCCGGGGATTAGGAGCACTCCCATCGAC
CAGGACGTCGACATTGTTCACTATCAGCCGGAGCAAGTGCATCTGTCCTT
TGGAGAAACCGTGCTCGACATTGTCGTCACCTGGAACACGCGCGACAACA
CCAACGAATCAATCTGTGAGTTCGGCATCGATGGACTGCATCAGCGAGTG
AAGGCGACGCAAATGCCCACGAAATTCGTGGATGGTGGAGCCAAAAAGGC
CACCCAGTATATACATCGTGTGACGCTGTCCCACCTGAAACCGAATAGCA
CCTATCTCTACCACTGTGGCAGTGAGTTGGGCTGGTCCGCCACCTATTGG
TTTCGGACGCGATTCGATCACGCCGACTGGTCGCCCTCGTTGGCGATCTA
CGGCGATATGGGCGTGGTGAATGCGGCATCCCTTCCAGCGCTGCAGCGTG
AAACGCAGAGCGGCCAGTACGACGCCATCATCCATGTGGGAGACTTCGCC
TACGACATGGACTGGGAAAACGGAGAGGTCGGCGACGAGTTTATGCGCCA
GGTGGAGACCATAGCCGCCTACTTACCATATATGGTGTGCGTGGGCAACC
ACGAGGAGAAGTACAACTTTTCGCACTACATCAATCGGTTCAGCATGCCG
GGTGGATCGGATAACATGTTCTATAGCTTCGATCTTGGACCGGTGCACTT
CATCGGTTTTAGCACAGAAGTCTATTATTTCACTAAGTTCGGGATCAAGC
AGATCGTGATGCAGTACGACTGGCTGGAGCGGGATTTGATCGAGGCCAAC
AAGCCAGAAAACCGGAAGAAGCGTCCCTGGATTATCACATACGGCCATCG
GCCCATGTACTGCAGCAATGACAACGGAGATGACTGTGCCAATCATGAGA
CAATCGTTCGAAAGGGTCTGCCCATGCTGGATTTCTTCGGGCTGGAGCCA
CTCTTTTATCAGTACGGCGTAGATATTGAATTGTGGGCACACGAGCACTG
CTACGAGCGGATGTGGCCCATGTACAACTACACCGTGTTCAATGGATCGC
TGGCCGAGCCGTATGTGAATCCCGGTGCACCAATACACATCATTTCGGGA
GCTGCCGGCAATCACGAGGGCAGGGAGCCATTCTTCAAGCGCATGCCTCC
GTGGAGTGCCTTCCACAGCCAGGACTTTGGGTATCTTCGACTGAAGGCCC
ACAACGGCACCCATCTACATTTCGAGCAGGTGTCCGATGACAAGAAGGGC
GAGGTCATCGATAGTTTCTGGGTGGTCAAGGACAAGCATGGACCGTACCA
GTCTGATCTCAACTCAAAAACTTTGGCAAGCTTTCTAGACCAT

BO29135.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-RE 1362 CG1637-PE 1..1359 17..1375 6795 100 Plus
CG1637-RA 1362 CG1637-PA 1..1359 17..1375 6795 100 Plus
CG1637-RB 1377 CG1637-PB 1..141 17..157 705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-RE 1868 CG1637-RE 341..1699 17..1375 6795 100 Plus
CG1637-RA 1773 CG1637-RA 246..1604 17..1375 6795 100 Plus
CG1637-RB 2196 CG1637-RB 246..386 17..157 705 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10872344..10873055 1375..664 3560 100 Minus
X 23542271 X 10873136..10873479 663..320 1720 100 Minus
X 23542271 X 10873541..10873710 323..154 850 100 Minus
X 23542271 X 10877415..10877553 155..17 695 100 Minus
X 23542271 X 10875242..10875479 662..425 320 75.6 Minus
X 23542271 X 10874489..10875145 1342..689 310 70.2 Minus
X 23542271 X 10870726..10870825 1341..1242 230 82 Minus
Blast to na_te.dros performed on 2014-11-26 22:28:42 has no hits.

BO29135.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:38 Download gff for BO29135.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 255..1613 17..1377 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:59:28 Download gff for BO29135.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 246..1604 17..1377 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:17 Download gff for BO29135.complete
Subject Subject Range Query Range Percent Splice Strand
CG1637-RA 246..1604 17..1377 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:17 Download gff for BO29135.complete
Subject Subject Range Query Range Percent Splice Strand
X 10877415..10877553 17..155 100   Minus
X 10873545..10873708 156..319 100 <- Minus
X 10873136..10873479 320..663 100 <- Minus
X 10872341..10873055 664..1377 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:59:28 Download gff for BO29135.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10771448..10771586 17..155 100   Minus
arm_X 10767578..10767741 156..319 100 <- Minus
arm_X 10767169..10767512 320..663 100 <- Minus
arm_X 10766374..10767088 664..1377 99 <- Minus

BO29135.pep Sequence

Translation from 16 to 1393

> BO29135.pep
MQRLQFALLASLLLLVLLLPGIRSTPIDQDVDIVHYQPEQVHLSFGETVL
DIVVTWNTRDNTNESICEFGIDGLHQRVKATQMPTKFVDGGAKKATQYIH
RVTLSHLKPNSTYLYHCGSELGWSATYWFRTRFDHADWSPSLAIYGDMGV
VNAASLPALQRETQSGQYDAIIHVGDFAYDMDWENGEVGDEFMRQVETIA
AYLPYMVCVGNHEEKYNFSHYINRFSMPGGSDNMFYSFDLGPVHFIGFST
EVYYFTKFGIKQIVMQYDWLERDLIEANKPENRKKRPWIITYGHRPMYCS
NDNGDDCANHETIVRKGLPMLDFFGLEPLFYQYGVDIELWAHEHCYERMW
PMYNYTVFNGSLAEPYVNPGAPIHIISGAAGNHEGREPFFKRMPPWSAFH
SQDFGYLRLKAHNGTHLHFEQVSDDKKGEVIDSFWVVKDKHGPYQSDLNS
KTLASFLDH

BO29135.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG1637-PE 453 CG1637-PE 1..453 1..453 2493 100 Plus
CG1637-PA 453 CG1637-PA 1..453 1..453 2493 100 Plus
CG1637-PB 458 CG1637-PB 1..458 1..446 1659 67.2 Plus
CG1637-PD 459 CG1637-PD 1..459 1..446 1653 66.9 Plus
CG1637-PC 450 CG1637-PC 1..448 1..446 1604 65.4 Plus