Clone BO29137 Report

Search the DGRC for BO29137

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptwupA-RC
Protein status:BO29137.pep: Imported from assembly
Sequenced Size:676

Clone Sequence Records

BO29137.complete Sequence

676 bp assembled on 2011-08-26

> BO29137.complete
GAAGTTATCAGTCGACATGGCTGATGATGAGGCTAAGAAGGCTAAACAGG
CTGAGATCGAGCGCAAGCGTGCTGAGGTGCGCAAGCGCATGGAGGAAGCC
TCCAAGGCCAAGAAGGCCAAGAAGGGTTTCATGACCCCAGAGAGGAAGAA
GAAACTCAGGTTGCTGCTGCGTAAGAAAGCCGCTGAGGAGCTGAAGAAAG
AACAGGAACGCAAAGCGGCTGAACGTAGACGCATCATCGAAGAACGTTGC
GGCAGTCCCAGGAATCTCAGCGATGCCAGCGAAGGCGAATTGCAAGAGAT
TTGCGAAGAGTATTACGAGCGTATGTATATTTGTGAAGGCCAGAAATGGG
ATCTGGAATACGAAGTCAGGAAAAAAGACTGGGAGATCAACGATCTCAAT
GCCCAAGTTAACGATCTTCGCGGCAAGTTCGTCAAGCCAGCCCTGAAGAA
GGTCTCCAAATACGAAAACAAATTCGCCAAGCTGCAGAAGAAGGCCGCTG
AGTTCAACTTCCGCAACCAGCTCAAGGTGGTGAAGAAGAAGGAGTTCACG
CTGGAGGAGGAGGAGAAGGAGAAGAAACCCGACTGGTCCAAGGGCAAGCC
CGGAGATGCCAAGGTGAAGGAGGAGGTTGAGGCCGAAGCTGCAAGCTTTC
TAGACCATTCGTTTGGCTTTAAGGGG

BO29137.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-RF 627 CG7178-PF 1..624 17..640 3120 100 Plus
wupA-RC 627 CG7178-PC 1..624 17..640 3120 100 Plus
wupA-RG 810 CG7178-PG 196..807 29..640 3060 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-RF 1129 CG7178-RF 110..733 17..640 3120 100 Plus
wupA-RC 1160 CG7178-RC 141..764 17..640 3120 100 Plus
wupA-RG 1343 CG7178-RG 336..947 29..640 3060 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18106681..18106822 571..430 710 100 Minus
X 23542271 X 18113447..18113577 160..30 655 100 Minus
X 23542271 X 18113257..18113382 285..160 630 100 Minus
X 23542271 X 18109470..18109572 385..283 515 100 Minus
X 23542271 X 18105964..18106034 640..570 355 100 Minus
X 23542271 X 18106888..18106933 429..384 230 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:31:03 has no hits.

BO29137.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:41 Download gff for BO29137.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RF 104..735 17..650 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:40 Download gff for BO29137.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 141..772 17..650 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:17 Download gff for BO29137.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RC 141..772 17..650 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:17 Download gff for BO29137.complete
Subject Subject Range Query Range Percent Splice Strand
X 18113447..18113575 32..160 100 <- Minus
X 18113258..18113381 161..284 100 <- Minus
X 18109470..18109570 285..385 100 <- Minus
X 18106888..18106931 386..429 100 <- Minus
X 18106681..18106822 430..571 100 <- Minus
X 18105956..18106032 572..650 94 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:40 Download gff for BO29137.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18007480..18007608 32..160 100 <- Minus
arm_X 18007291..18007414 161..284 100 <- Minus
arm_X 18003503..18003603 285..385 100 <- Minus
arm_X 18000921..18000964 386..429 100 <- Minus
arm_X 18000714..18000855 430..571 100 <- Minus
arm_X 17999989..18000065 572..650 94 <- Minus

BO29137.pep Sequence

Translation from 16 to 676

> BO29137.pep
MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLL
LRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYY
ERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYE
NKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKV
KEEVEAEAASFLDHSFGFKG

BO29137.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PF 208 CG7178-PF 1..208 1..208 1063 100 Plus
wupA-PC 208 CG7178-PC 1..208 1..208 1063 100 Plus
wupA-PG 269 CG7178-PG 65..269 4..208 1044 99.5 Plus
wupA-PE 208 CG7178-PE 1..208 1..208 952 91.3 Plus
wupA-PD 208 CG7178-PD 1..208 1..208 952 91.3 Plus