Clone BO29138 Report

Search the DGRC for BO29138

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG32521-RA
Protein status:BO29138.pep: Imported from assembly
Sequenced Size:1198

Clone Sequence Records

BO29138.complete Sequence

1198 bp assembled on 2011-08-26

GenBank Submission: KX797983

> BO29138.complete
GAAGTTATCAGTCGACATGCTGGCACTGCCTTTGCTGACTCTGGCGGTCC
TCGCCAGCTGCGGCTACTCCGTGGACGCCTACTCCAAGTACGGCCGTGGA
TGCGGGGACATTGGCTGCCTGCCCACCGAGGAGTGCGTCATCACCAGCGA
CTCGTGCAGCTACAACCAGCGTGACGGCAAGGATTGCGGCAACTATCCCA
CCTGCAAACGGCGCTCCGGCGGAGGATCATCCGCCTCGAACAGCAGCCCC
AACTTGGCAGCCCCCTCGGCCAATCCGTCAGAGGTGAGCCATAACGCATA
CGCCCCGAATGCCCCAAGTGCCCCGAGTGCCCCGTTGCCGGAAGCGGATG
CGAGCGGTGGTGCTGGCTACGGTGGTGCTGCGGGCGGTGGTGGAAGCGGC
GGATATGGTGGTGGTTTCTCGGCTGGCGGCCACTCCCTGTACCCCAGCCT
ACCCAACTCAAACGGCGGCGGCGGTGGTGCGGCTCCCTACAATCCATATG
GCAGTGGTGGCGGCAACGGTGGATACGGCGGCTACAATCCCTACAACGGC
GGCTACCAGCCACCATCTTCTGGCGGCTATCAACCTCAAGCTCCTGGCGG
ATACCAACCCAGACCGGGCTACACGCCACCCGCCCCAGGCTACGATAACA
ACGGTGGTGGTGGTGCCCAGAAACCCAAGGACAAAGAGGGCGGCTTCTTC
TCCAATTTCTTCTCGAATCCGGCGGTGAGTCAAGCGGTGTCCGGTATCAT
TGCAGGCCAGATAGCCAAGCAACTGCAAGGCGGCGGAGCCGGAGGACCAG
GTGGTGGACAGCCGGCTGGCGGCTACCAGCCAAGCGGTGGCTATGGCGGA
GGACCAGCAGCAGGAGGCGGCGGATCCGGTGGTAGTAACATACTTGGCGG
TCTCTTGGGATCCGTTCTATCCGGCGGCGGTGGTGGTAATGCAGGCGCTG
GCGGCGGTAGTGCTAGCAGCTTCCTGGGGAGTCTGCTCAGCGGTGGAAAT
TCCAACAGAGGCGCTCAGCAAGGAGGCGGAGGTTCTGGAGGACTGGGCGA
CATCTTCAGCTCGAAAAACTTTGGCGGCCTCTTCAGTGAGAATCCCTCAT
CCAGGAGCGGCAGTCCCTCATCCTCCTCCGACGGAGGAGCCAAGGGCTAT
CCCACCCAGGCACCGGGCAACTATTATGGCGCAAGCTTTCTAGACCAT

BO29138.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-RD 1167 CG32521-PD 1..1164 17..1180 5820 100 Plus
CG32521-RB 1167 CG32521-PB 1..1164 17..1180 5820 100 Plus
CG32521-RA 1167 CG32521-PA 1..1164 17..1180 5820 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-RD 1691 CG32521-RD 152..1315 17..1180 5820 100 Plus
CG32521-RB 1782 CG32521-RB 243..1406 17..1180 5820 100 Plus
CG32521-RA 1714 CG32521-RA 175..1338 17..1180 5820 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21205686..21206587 1180..279 4510 100 Minus
X 23542271 X 21211080..21211274 281..87 975 100 Minus
X 23542271 X 21211687..21211756 86..17 350 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:31:26 has no hits.

BO29138.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:41 Download gff for BO29138.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RB 243..1406 17..1182 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:52 Download gff for BO29138.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 175..1338 17..1182 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:26 Download gff for BO29138.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 175..1338 17..1182 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:26 Download gff for BO29138.complete
Subject Subject Range Query Range Percent Splice Strand
X 21211687..21211756 17..86 100   Minus
X 21211080..21211274 87..281 100 <- Minus
X 21205684..21206584 282..1182 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:52 Download gff for BO29138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21082714..21082783 17..86 100   Minus
arm_X 21082107..21082301 87..281 100 <- Minus
arm_X 21076711..21077611 282..1182 99 <- Minus

BO29138.pep Sequence

Translation from 16 to 1198

> BO29138.pep
MLALPLLTLAVLASCGYSVDAYSKYGRGCGDIGCLPTEECVITSDSCSYN
QRDGKDCGNYPTCKRRSGGGSSASNSSPNLAAPSANPSEVSHNAYAPNAP
SAPSAPLPEADASGGAGYGGAAGGGGSGGYGGGFSAGGHSLYPSLPNSNG
GGGGAAPYNPYGSGGGNGGYGGYNPYNGGYQPPSSGGYQPQAPGGYQPRP
GYTPPAPGYDNNGGGGAQKPKDKEGGFFSNFFSNPAVSQAVSGIIAGQIA
KQLQGGGAGGPGGGQPAGGYQPSGGYGGGPAAGGGGSGGSNILGGLLGSV
LSGGGGGNAGAGGGSASSFLGSLLSGGNSNRGAQQGGGGSGGLGDIFSSK
NFGGLFSENPSSRSGSPSSSSDGGAKGYPTQAPGNYYGASFLDH

BO29138.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-PD 388 CG32521-PD 1..388 1..388 2116 100 Plus
CG32521-PB 388 CG32521-PB 1..388 1..388 2116 100 Plus
CG32521-PA 388 CG32521-PA 1..388 1..388 2116 100 Plus
CG32521-PI 323 CG32521-PI 23..323 88..388 1641 99.7 Plus
CG32521-PG 230 CG32521-PG 53..230 210..388 765 84.9 Plus