Clone BO29139 Report

Search the DGRC for BO29139

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:39
Vector:pDNR-Dual
Associated Gene/Transcriptpip-RC
Protein status:BO29139.pep: Imported from assembly
Sequenced Size:1243

Clone Sequence Records

BO29139.complete Sequence

1243 bp assembled on 2011-08-26

GenBank Submission: KX797018

> BO29139.complete
GAAGTTATCAGTCGACATGTCTCTGAACGCCGAGCGATCGTACAAAATGA
AACTGCGCGATGTGGAAAATGCCTTCAAATACCGGCGCATACCGTATCCC
AAGCGTTCCGTCGAGCTGATCGCCCTGCTGGCTATTTCGTGCACCTTCTT
CCTGTTCATGCACACCAACAAACTGAACAGTCGCCTCAAGGAGATGGAGG
TGAAGCTGCAGCCATCGGAGTTTTCGGCCCTCGGTCTAACGGGCAACCAC
ATCAGCGGACACGATGCGGGCAAGCACGATGACATCAACACCCTGCACGG
CACCTACCAATATCTGAAGAGCACTGGCCAGCTGTGGCGATTAAATCCGA
AATTTCTAAATAACACCAAGTTTCACTTTCGCGATATTATCTTCTACAAT
CGAGTTCCCAAGACGGGCAGTGAAACGCTGATCGAGTTGATGATTCAACT
TGGAAAAAAGAACGACTTTCAGAACGAAAGGTCTCCGTTTTCGAAACCCA
CTGGAATGTACTGGGATGTGAAGCGGCAAAAGCAGGAAGCCACGCGCATC
CTGGAGTTGCAGGAGGAACCAGCCTTTGTCTATGTAGAGCACATGAACTA
CATGAACATTCGCCCCTTTCACCTACCCCAACCAATCTACATCAACATGA
TTCGAGACCCCGTAGAACGAGTGATCAGCTGGTTCTACTATAAACGCACT
CCCTGGAACTCTGTCAAAATGTACAAGGTGACGGGGAAATTTCAGAATCG
CACCCACTACACCAAGAACTTTGAGGAATGCGTCCTTACACACGATCCGG
AATGTCGATATGACTACGGACTTCTGTTCAAGGACGATTCTGCCGATCAC
AAGCGTCAGAGCCTGTTCTTCTGCGGACACTCCCCCATTTGCGAACCCTT
CAATACACCGGCGGCAATTGCGAGGGCCAAGCAAAACGTAGAGCGAGATT
TCTCAGTGGTTGGTTCCTGGGAGGATACGAATGTCACTTTGACAGTGCTC
GAGCACTATATACCGCGATTCTTCAAGGGCACTATGGAGCTGTACTATGA
ACCCAATATCGGTCTGGCCTTTAAGAAGGCGAATATCAACCCCTGGAAGC
CGAAAATTAGCGAGCGAATCAAGCAAATAATGCGGGCTAACTTCACTCAG
GAATACGAATTTTATTACTTTTGCAAGCAGCGCTTGTATCGCCAATACTT
TGCAATAAATAAGCAATTGCACTTCGCAAGCTTTCTAGACCAT

BO29139.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RC 1212 CG9614-PC 1..1209 17..1225 6045 100 Plus
pip-RF 1194 CG9614-PF 1..318 17..334 1590 100 Plus
pip-RM 879 CG9614-PM 1..317 17..333 1585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RC 1397 CG9614-RC 180..1388 17..1225 6045 100 Plus
pip-RF 1441 CG9614-RF 180..497 17..334 1590 100 Plus
pip-RM 2975 CG9614-RM 180..496 17..333 1585 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19308756..19309076 649..329 1605 100 Minus
3L 28110227 3L 19308455..19308700 894..649 1230 100 Minus
3L 28110227 3L 19308003..19308179 1225..1049 885 100 Minus
3L 28110227 3L 19318784..19318951 272..105 840 100 Minus
3L 28110227 3L 19308241..19308395 1049..895 775 100 Minus
3L 28110227 3L 19337342..19337430 105..17 445 100 Minus
3L 28110227 3L 19313156..19313214 331..273 295 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:32:26 has no hits.

BO29139.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:42 Download gff for BO29139.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 170..1378 17..1227 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:01:27 Download gff for BO29139.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 180..1388 17..1227 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:53 Download gff for BO29139.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 180..1388 17..1227 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:53 Download gff for BO29139.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19337342..19337430 17..105 100   Minus
3L 19318784..19318950 106..272 100 <- Minus
3L 19313156..19313214 273..331 100 <- Minus
3L 19308756..19309073 332..649 100 <- Minus
3L 19308455..19308699 650..894 100 <- Minus
3L 19308241..19308395 895..1049 100 <- Minus
3L 19308000..19308178 1050..1227 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:01:27 Download gff for BO29139.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19330442..19330530 17..105 100   Minus
arm_3L 19311884..19312050 106..272 100 <- Minus
arm_3L 19306256..19306314 273..331 100 <- Minus
arm_3L 19301856..19302173 332..649 100 <- Minus
arm_3L 19301555..19301799 650..894 100 <- Minus
arm_3L 19301341..19301495 895..1049 100 <- Minus
arm_3L 19301100..19301278 1050..1227 98 <- Minus

BO29139.pep Sequence

Translation from 16 to 1243

> BO29139.pep
MSLNAERSYKMKLRDVENAFKYRRIPYPKRSVELIALLAISCTFFLFMHT
NKLNSRLKEMEVKLQPSEFSALGLTGNHISGHDAGKHDDINTLHGTYQYL
KSTGQLWRLNPKFLNNTKFHFRDIIFYNRVPKTGSETLIELMIQLGKKND
FQNERSPFSKPTGMYWDVKRQKQEATRILELQEEPAFVYVEHMNYMNIRP
FHLPQPIYINMIRDPVERVISWFYYKRTPWNSVKMYKVTGKFQNRTHYTK
NFEECVLTHDPECRYDYGLLFKDDSADHKRQSLFFCGHSPICEPFNTPAA
IARAKQNVERDFSVVGSWEDTNVTLTVLEHYIPRFFKGTMELYYEPNIGL
AFKKANINPWKPKISERIKQIMRANFTQEYEFYYFCKQRLYRQYFAINKQ
LHFASFLDH

BO29139.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PC 403 CG9614-PC 1..403 1..403 2182 100 Plus
pip-PG 407 CG9614-PG 1..407 1..408 1248 60.2 Plus
pip-PA 413 CG9614-PA 1..393 1..396 1185 59.8 Plus
pip-PD 418 CG9614-PD 1..393 1..397 1177 59.1 Plus
pip-PH 405 CG9614-PH 1..396 1..399 1156 56.9 Plus