Clone BO29141 Report

Search the DGRC for BO29141

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:41
Vector:pDNR-Dual
Associated Gene/Transcriptl(1)G0334-RA
Protein status:BO29141.pep: Imported from assembly
Sequenced Size:1231

Clone Sequence Records

BO29141.complete Sequence

1231 bp assembled on 2011-08-26

GenBank Submission: KX795117

> BO29141.complete
GAAGTTATCAGTCGACATGTTGCGTACTCTGTCACGCGTTAGCGAATTGC
CCATTATTGTTAAGCAACTGCAAAAAAATGCAGCCCAAGCAGGTGTTTCG
AAAACCAACAATTATGCCACGGAGGCCACCGTTCAAGTGAATCGGCCCTT
CAAGCTGCACCGCCTGGACGAAGGACCCGCCACGGAAGTGAAGCTGACCA
AGGATCAGGCCCTTAAGTACTACACACAGATGCAGACGATCCGTCGGTTG
GAGACGGCCGCCGGTAATCTGTACAAGGAGAAGATCATTCGCGGCTTCTG
TCATCTGTATTCCGGCCAGGAGGCATGCGCCGTTGGCATGAAGGCGGCGA
TGCGGGATGTGGACAACATCATATCGGCGTACCGTGTCCACGGATGGACC
TACCTGATGGGCGTCTCACCCAGCGGCGTACTGGCTGAGCTCACCGGTGT
CCAGGGTGGCTGTGCCCGCGGCAAGGGTGGCTCCATGCACATGTACGCAC
CGAACTTCTACGGAGGCAATGGCATCGTGGGTGCTCAAGTTCCTTTGGGC
GCCGGCGTTGGCTTGGCCTGCAAGTACAAGGGCAATGGCGGCATGTGCCT
GGCCCTCTACGGTGATGGTGCCGCCAATCAGGGACAGGTGTTCGAGGCCT
ACAACATGGCCTACCTGTGGAAACTGCCTGTGATCTTTGTCTGCGAGAAC
AACAACTACGGAATGGGTACCAGTTCTGAGCGTGCTTCCTGCAACACTGA
TTACTATACCCGCGGCGACGCTCTGCCCGGAATCTGGGTGGACGGCATGG
ATGTGCTGGCCGTGCGCAGCGCCACCGAGTTCGCCATCAACTATGTGAAC
ACTCACGGACCTTTGGTGATGGAGACGAACACGTACCGATACTCTGGACA
CTCCATGTCCGATCCGGGCACATCGTACCGCACACGCGAGGAGATCCAGG
AGGTGCGCCAGAAGCGTGATCCCATCACCTCCTTCAAGGAGCTGTGCATC
GAGCTGGGTCTGATTACCACCGATGAAGTTAAGGCCATCGATCTGAAGGT
ACGCAAGGAGGTCGACGAGGCCACCGCCTTCGCCAAGTCCGATGCCGAGC
TGGGCGTGAGCCACCTCTGGACGGACGTGTACTCCAACAATCTGGAGCCC
AAGCTGCGCGGCACCATCGCCTACGATATTGATCACATCCAGGAGCGCAA
GGGCGTCAATCACGCAAGCTTTCTAGACCAT

BO29141.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-RD 1200 CG7010-PD 1..1197 17..1213 5895 99.5 Plus
l(1)G0334-RA 1200 CG7010-PA 1..1197 17..1213 5895 99.5 Plus
l(1)G0334-RC 1332 CG7010-PC 193..1329 77..1213 5595 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-RD 1667 CG7010-RD 115..1311 17..1213 5895 99.5 Plus
l(1)G0334-RA 1760 CG7010-RA 208..1404 17..1213 5895 99.5 Plus
l(1)G0334-RB 1992 CG7010-RB 500..1636 77..1213 5595 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4703554..4704120 145..711 2760 99.1 Plus
X 23542271 X 4704194..4704518 710..1034 1610 99.7 Plus
X 23542271 X 4704586..4704767 1032..1213 910 100 Plus
X 23542271 X 4702824..4702892 77..145 345 100 Plus
X 23542271 X 4702532..4702591 17..76 300 100 Plus
X 23542271 X 4706325..4706790 466..931 295 71.9 Plus
Blast to na_te.dros performed on 2014-11-26 22:32:47 has no hits.

BO29141.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:42 Download gff for BO29141.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RD 120..1311 22..1215 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:01:38 Download gff for BO29141.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RA 213..1404 22..1215 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:04:01 Download gff for BO29141.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0334-RA 213..1404 22..1215 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:04:01 Download gff for BO29141.complete
Subject Subject Range Query Range Percent Splice Strand
X 4704588..4704767 1034..1215 98   Plus
X 4704195..4704517 711..1033 99 -> Plus
X 4703555..4704119 146..710 99 -> Plus
X 4702824..4702892 77..145 100 -> Plus
X 4702537..4702591 22..76 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:01:38 Download gff for BO29141.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4598621..4598800 1034..1215 98   Plus
arm_X 4598228..4598550 711..1033 99 -> Plus
arm_X 4597588..4598152 146..710 99 -> Plus
arm_X 4596857..4596925 77..145 100 -> Plus
arm_X 4596570..4596624 22..76 100 -> Plus

BO29141.pep Sequence

Translation from 16 to 1231

> BO29141.pep
MLRTLSRVSELPIIVKQLQKNAAQAGVSKTNNYATEATVQVNRPFKLHRL
DEGPATEVKLTKDQALKYYTQMQTIRRLETAAGNLYKEKIIRGFCHLYSG
QEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCA
RGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGD
GAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRG
DALPGIWVDGMDVLAVRSATEFAINYVNTHGPLVMETNTYRYSGHSMSDP
GTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVD
EATAFAKSDAELGVSHLWTDVYSNNLEPKLRGTIAYDIDHIQERKGVNHA
SFLDH

BO29141.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0334-PD 399 CG7010-PD 1..399 1..399 2097 100 Plus
l(1)G0334-PA 399 CG7010-PA 1..399 1..399 2097 100 Plus
l(1)G0334-PC 443 CG7010-PC 1..443 1..399 2042 90.1 Plus
l(1)G0334-PB 328 CG7010-PB 1..328 72..399 1744 100 Plus
CG7024-PA 479 CG7024-PA 43..390 45..392 1142 59.8 Plus