Clone BO29143 Report

Search the DGRC for BO29143

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:43
Vector:pDNR-Dual
Associated Gene/Transcriptgish-RE
Protein status:BO29143.pep: Imported from assembly
Sequenced Size:1423

Clone Sequence Records

BO29143.complete Sequence

1423 bp assembled on 2011-08-26

GenBank Submission: KX798110

> BO29143.complete
GAAGTTATCAGTCGACATGCAGCGACGAGAACGGCAAGCAAGTGGCGGTG
GCCCACAAACGACAACTGCCGGTCCATCCGCTGGTAATGTGGCAAATGCC
ACCACAGCCCTAGCCGGTGGTAAAAGCTCAAGCAATAACATGTATTCCAC
CCGCCAATCTGTAAGCACCACGACCGGTGTACTTATGGTCGGACCAAATT
TTCGTGTCGGTAAAAAAATTGGCTGTGGTAATTTTGGCGAATTGCGTTTA
GGCAAAAACCTTTACAACAATGAACATGTAGCAATAAAAATGGAGCCTAT
GAAGTCAAAGGCTCCGCAACTACACTTAGAGTATAGGTTTTATAAACTAT
TAGGATCACATGCAGAGGGTGTACCAGAAGTATATTACTTCGGCCCATGC
GGCAAATACAATGCTCTTGTTATGGAGTTGCTTGGTCCATCACTTGAAGA
TTTATTCGATATTTGCGGCAGACGTTTCACTTTGAAGAGCGTACTTCTGA
TAGCTATACAATTACTCCACCGGATCGAATATGTTCATAGTCGGCACTTA
ATATATAGGGATGTGAAACCAGAGAACTTTCTCATTGGCAGAACGTCAAC
AAAACGTGAAAAAATTATACATATAATTGATTTCGGTTTGGCCAAAGAAT
ACATTGATTTAGATACAAATAGGCATATACCATATCGGGAGCATAAATCC
CTAACTGGAACGGCACGTTATATGTCAATCAACACGCACATGGGGCGTGA
GCAGTCGCGACGCGATGATCTGGAGGCATTGGGGCATATGTTTATGTATT
TCTTAAGGGGTTCACTGCCGTGGCAAGGCCTAAAGGCTGATACACTCAAG
GAGAGATATCAAAAAATCGGTGATACGAAACGAGCAACGCCCATCGAGGT
GCTTTGTGATGGACATCCGGAAGAGTTTGCGACATATTTGCGTTATGTAC
GGCGGTTAGATTTTTTCGAAACTCCCGACTATGATTTTCTGCGAAGACTG
TTTCAAGACTTATTCGATCGTAAGGGATACACCGACGAGGGCGAGTTCGA
CTGGACAGGGAAGACAATGTCAACGCCCGTCGGATCTCTGCAAACTGGCC
ATGAAGTCATCATTTCACCAAATAAAGATCGTCATAATGTTACGGCTAAG
ACAAATGCCAAAGGAGGTGTTGCTGCGTGGCCTGATGTGCCAAAGCCGGG
GGCAACACTGGGCAATCTAACGCCGGCCGATCGGCATGGTTCAGTACAGG
TTGTGAGTTCGACGAATGGCGAACTAAATCCGGACGATCCCACGGCCGGA
CACTCAAACACGCCCATCACACAGCAGCCGGAAGTCGAAGTGGTCGATGA
AACAAAATGTTGTTGTTTCTTTAAACGAAAGAAGAAGAAATCGACGCGCC
AAAAAGCAAGCTTTCTAGACCAT

BO29143.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
gish-RE 1392 CG6963-PE 1..1389 17..1405 6945 100 Plus
gish-RA 1269 CG6963-PA 1..1266 140..1405 6330 100 Plus
gish-RM 1407 CG6963-PM 497..1404 498..1405 4480 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
gish-RE 3212 CG6963-RE 1319..2711 13..1405 6950 99.9 Plus
gish-RA 2677 CG6963-RA 464..1827 42..1405 6820 100 Plus
gish-RM 5623 CG6963-RM 1819..2726 498..1405 4480 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16296835..16297107 629..901 1365 100 Plus
3R 32079331 3R 16289629..16289840 41..252 1060 100 Plus
3R 32079331 3R 16297173..16297345 897..1069 865 100 Plus
3R 32079331 3R 16295668..16295820 362..514 765 100 Plus
3R 32079331 3R 16296662..16296776 515..629 575 100 Plus
3R 32079331 3R 16292722..16292834 250..362 565 100 Plus
3R 32079331 3R 16301242..16301351 1247..1356 550 100 Plus
3R 32079331 3R 16299589..16299691 1149..1251 515 100 Plus
3R 32079331 3R 16298469..16298550 1069..1150 410 100 Plus
3R 32079331 3R 16301823..16301871 1357..1405 245 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:35:09 has no hits.

BO29143.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:43 Download gff for BO29143.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1317..2700 17..1400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:02:49 Download gff for BO29143.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1323..2706 17..1400 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:01 Download gff for BO29143.complete
Subject Subject Range Query Range Percent Splice Strand
gish-RE 1323..2706 17..1400 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:01 Download gff for BO29143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16301823..16301866 1357..1400 100   Plus
3R 16301245..16301351 1250..1356 100 -> Plus
3R 16299591..16299689 1151..1249 100 -> Plus
3R 16298470..16298550 1070..1150 100 -> Plus
3R 16297175..16297345 899..1069 100 -> Plus
3R 16296836..16297104 630..898 100 -> Plus
3R 16296662..16296776 515..629 100 -> Plus
3R 16295669..16295820 363..514 100 -> Plus
3R 16292724..16292834 252..362 100 -> Plus
3R 16289631..16289839 43..251 100 -> Plus
3R 16275144..16275169 17..42 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:02:49 Download gff for BO29143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12127545..12127588 1357..1400 100   Plus
arm_3R 12126967..12127073 1250..1356 100 -> Plus
arm_3R 12125313..12125411 1151..1249 100 -> Plus
arm_3R 12124192..12124272 1070..1150 100 -> Plus
arm_3R 12122897..12123067 899..1069 100 -> Plus
arm_3R 12122558..12122826 630..898 100 -> Plus
arm_3R 12122384..12122498 515..629 100 -> Plus
arm_3R 12121391..12121542 363..514 100 -> Plus
arm_3R 12118446..12118556 252..362 100 -> Plus
arm_3R 12115353..12115561 43..251 100 -> Plus
arm_3R 12100866..12100891 17..42 100 -> Plus

BO29143.pep Sequence

Translation from 16 to 1423

> BO29143.pep
MQRRERQASGGGPQTTTAGPSAGNVANATTALAGGKSSSNNMYSTRQSVS
TTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAP
QLHLEYRFYKLLGSHAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDIC
GRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKI
IHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRD
DLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGH
PEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKT
MSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGATLGN
LTPADRHGSVQVVSSTNGELNPDDPTAGHSNTPITQQPEVEVVDETKCCC
FFKRKKKKSTRQKASFLDH

BO29143.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
gish-PE 463 CG6963-PE 1..463 1..463 2461 100 Plus
gish-PM 468 CG6963-PM 1..468 1..463 2357 95.1 Plus
gish-PL 537 CG6963-PL 1..468 1..463 2357 95.1 Plus
gish-PH 468 CG6963-PH 1..468 1..463 2357 95.1 Plus
gish-PD 468 CG6963-PD 1..468 1..463 2357 95.1 Plus