Clone BO29144 Report

Search the DGRC for BO29144

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptUGP-RD
Protein status:BO29144.pep: Imported from assembly
Sequenced Size:1567

Clone Sequence Records

BO29144.complete Sequence

1567 bp assembled on 2011-08-26

GenBank Submission: KX794484

> BO29144.complete
GAAGTTATCAGTCGACATGCTGGATGTTCCACATGAAGCTAAGGTGCGCG
GCCACCAGCGTGCACCGTCCGACTCCAAGGAGTTCCATGAGGTGACCAAA
CGGGATGCACTTCGTCTGCTGGAGCACGATGTGGACCGTCTGCTGGAGAC
CACTGAGAAGGCCCGCCAGCCTGCCCTCAAGGCAGAAATGGGTCGTTTCG
CCGATCTGTTCGGACGTTTCATTCAGGAAGAGGGTCCCGCATTGGACTGG
AACAAGATTCAGAAGCTGCCTGAGAATGCTGTGATGAACTACTCGAATCT
TAAGTCGCCCAAGAACGAGCAGATCCGCAACATGTTGGATAAATTGGTGG
TCATCAAGCTGAACGGTGGTTTGGGCACCTCAATGGGTTGCCATGGTCCC
AAGAGTGTGATTCCTGTGCGTTCGGATCTTACTTTCCTGGATCTGACCGT
GCAGCAAATCGAGCATCTCAACAAGACCTACGATGCCAATGTTCCGCTGG
TACTGATGAACTCCTTTAACACCGACGAGGATACCGAGAAGATCGTGCGC
AAGTACAAAGGATTCCGTGTGCAGATCCACACCTTCAACCAGAGCTGCTT
CCCGCGCATTAGTCGCGAGCACTACCTGCCGGTGGCCAAAGACTTTGATG
TCGAAAAGGATATGGAAGCCTGGTATCCACCTGGACACGGTGACTTCTAC
GATACCTTCCGCAACTCTGGCCTGCTGAAGAAGTTCATCGAGGAGGGCCG
CGAGTATTGTTTCTTGTCCAACATCGATAACCTGGGCGCCACCGTCGATC
TGAACATCCTCAATAAGCTGGTGGGCGAGGAGCGGGCCACTACTCCAGTG
GAGTTTGTCATGGAGGTCACCGACAAGACCCGTGCTGACGTTAAGGGTGG
TACTCTCATTCAAATGGAAAACAAGCTGCGCCTGTTGGAAATTGCTCAAG
TGCCACCAGAGCATGTGGATGACTTTAAGTCGGTTAAGACCTTCAAGTTC
TTTAACACCAACAACATTTGGGCCAACCTGGCAGCCATTGATCGCGTTTT
GCGTGAGCGTACCTTAAACATGGAAATTATTGTGAACAACAAGACGCTGG
AGAACGGAACCCGTGTCATTCAGCTGGAGACTGCTGTGGGTGCGGCCATG
AAGTGCTTTGATGGCGCCATCGGCATCAATGTGCCGCGTTCCCGTTTCTT
GCCCGTGAAGAAATCTTCAGATCTGCTGCTGGTCATGTCAAATTTATATA
CGCTTAAGAACGGCAGCCTGGTAATGTCGCCACAGCGAATGTTCCCTACC
ACGCCGCTCGTCAAGCTGGGAGAGAACCACTTCTCGAAGGTCAAGGAGTT
CCTGGGTCGCTTTGCCAACATCCCGGACATCATTGAGCTGGATCACTTGA
CCGTGAGCGGAGATGTGACTTTCGGTCGTGGCGTTTCTTTGCGCGGCACT
GTGATCATCATTGCTAACCATGGCGATCGTATCGATATCCCAGCTGGAGC
CATTCTGGAGAACAAGATTGTATCTGGCAATATGCGCATCTTGGACCACG
CAAGCTTTCTAGACCAT

BO29144.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-RD 1536 CG4347-PD 1..1533 17..1549 7665 100 Plus
UGP-RC 1542 CG4347-PC 1..1539 17..1549 7570 99.6 Plus
UGP-RE 1557 CG4347-PE 49..1554 44..1549 7530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-RD 2093 CG4347-RD 295..1827 17..1549 7665 100 Plus
UGP-RC 2099 CG4347-RC 295..1833 17..1549 7570 99.6 Plus
UGP-RE 2686 CG4347-RE 302..1807 44..1549 7530 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9351917..9352329 1445..1033 2065 100 Minus
3L 28110227 3L 9352882..9353230 669..321 1745 100 Minus
3L 28110227 3L 9352601..9352827 896..670 1135 100 Minus
3L 28110227 3L 9353888..9354076 230..42 945 100 Minus
3L 28110227 3L 9352405..9352545 1034..894 705 100 Minus
3L 28110227 3L 9351746..9351850 1549..1445 525 100 Minus
3L 28110227 3L 9353738..9353831 322..229 470 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:52:43 has no hits.

BO29144.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 16:34:45 Download gff for BO29144.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 291..1823 17..1551 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:37:09 Download gff for BO29144.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 295..1827 17..1551 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:12:15 Download gff for BO29144.complete
Subject Subject Range Query Range Percent Splice Strand
UGP-RD 295..1827 17..1551 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:12:15 Download gff for BO29144.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9358615..9358641 17..43 100   Minus
3L 9353888..9354074 44..230 100 <- Minus
3L 9353738..9353829 231..322 100 <- Minus
3L 9352882..9353228 323..669 100 <- Minus
3L 9352602..9352827 670..895 100 <- Minus
3L 9352405..9352543 896..1034 100 <- Minus
3L 9351918..9352327 1035..1444 100 <- Minus
3L 9351744..9351850 1445..1551 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:37:09 Download gff for BO29144.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9351715..9351741 17..43 100   Minus
arm_3L 9346988..9347174 44..230 100 <- Minus
arm_3L 9346838..9346929 231..322 100 <- Minus
arm_3L 9345982..9346328 323..669 100 <- Minus
arm_3L 9345702..9345927 670..895 100 <- Minus
arm_3L 9345505..9345643 896..1034 100 <- Minus
arm_3L 9345018..9345427 1035..1444 100 <- Minus
arm_3L 9344844..9344950 1445..1551 98 <- Minus

BO29144.pep Sequence

Translation from 16 to 1567

> BO29144.pep
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKAR
QPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKN
EQIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEH
LNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISR
EHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFL
SNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTL
NMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKS
SDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFA
NIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENK
IVSGNMRILDHASFLDH

BO29144.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
UGP-PD 511 CG4347-PD 1..511 1..511 2643 100 Plus
UGP-PC 513 CG4347-PC 1..513 1..511 2630 99.6 Plus
UGP-PE 518 CG4347-PE 15..518 8..511 2597 99.8 Plus
UGP-PA 520 CG4347-PA 15..520 8..511 2584 99.4 Plus