Clone BO29151 Report

Search the DGRC for BO29151

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG11378-RA
Protein status:BO29151.pep: Imported from assembly
Sequenced Size:970

Clone Sequence Records

BO29151.complete Sequence

970 bp assembled on 2011-08-26

GenBank Submission: KX798066

> BO29151.complete
GAAGTTATCAGTCGACATGAACAAGTACGGGATGGTCGGCGTCTGCCTAC
TGGCTGCTCTGGGCGCTCTGCTCCTGGAGGTCACTGCCTCTCCTTCGTCC
GCCGCCTCGTCTAAGGTGGATCCTAGCCAACTTGGCGGACTTTCAGCTCA
GTTCTTGCCACCCGAGTACCGCAACACGAACGTTAGCATCGAGGATATAA
AAAGAATATATCGTGAAAAATGCAAGAAGGTAAATGGAGCGGACAACGCA
ACCTTCTACGAAGAAATCGAGCGGGCGGCAGCCAAGATGAGCACCTGCAT
CAGCGGGGTGGTCAATCTGACGGCTCTGCAGGAGGAGATGGATGTGGCGA
GGCCGAACGGCGACTTGGACACCGTGTTTAGCAAATACTGTCTCAAGGCA
CCGGAGGCAGAGGCCTGCGTCAAGGAGTTCAACGACAAGGCGCAGCATTG
CTTGACCCCCGAGGAGAAGCGCCACCAGGAGACGGTTACCCGAATTGGAG
CGTCCGTTTTGGGATTCGCCTGTTCGCGTGGCGGCGATCAGATTGCCCTC
TTCATTGCCGAGCAGGGACCCGAGTGCCTGGAGGCCAACAAGGAAGCCAT
TAGCAATTGCCTCAATCAATCCTTTCATCAGTACATTCCCAAGGATGGCC
AAGTTCCGGACCTGATGAGCCGCCCAGAGCTCCTTTTCTCACCCACCCAC
TGCGTGGACCTGCAGCGCTTCGAGGCCTGTGTCATCCATCATTTGGAGCA
GTGCACGCAGATCACCACCGCTAATATCGTTCAGTCCGTCTTCCGTTTCG
TGAAGAACGAGACCGACTGCCAGGCTTGGATGCAGGCACGTGCGAACGAG
AAGCCCATTCTGATGGCCGCCTCCAGCAACAACACAGCCCCTGGACTCGC
CTACTCCCTGGCCGGCACTCTTTTGGGCGCCACAATACTCCTGATACTCC
CCGCAAGCTTTCTAGACCAT

BO29151.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-RC 939 CG11378-PC 1..936 17..952 4680 100 Plus
CG11378-RB 939 CG11378-PB 1..936 17..952 4680 100 Plus
CG11378-RA 939 CG11378-PA 1..936 17..952 4680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-RC 2256 CG11378-RC 99..1035 16..952 4685 100 Plus
CG11378-RB 1698 CG11378-RB 598..1534 16..952 4685 100 Plus
CG11378-RA 1199 CG11378-RA 99..1035 16..952 4685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1171815..1172576 191..952 3810 100 Plus
X 23542271 X 1171523..1171698 16..191 880 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:35:51 has no hits.

BO29151.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:44 Download gff for BO29151.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 96..1031 17..954 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:03:09 Download gff for BO29151.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 100..1035 17..954 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:19 Download gff for BO29151.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 100..1035 17..954 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:19 Download gff for BO29151.complete
Subject Subject Range Query Range Percent Splice Strand
X 1171816..1172576 192..954 99   Plus
X 1171524..1171698 17..191 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:03:09 Download gff for BO29151.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1065849..1066609 192..954 99   Plus
arm_X 1065557..1065731 17..191 100 -> Plus

BO29151.pep Sequence

Translation from 16 to 970

> BO29151.pep
MNKYGMVGVCLLAALGALLLEVTASPSSAASSKVDPSQLGGLSAQFLPPE
YRNTNVSIEDIKRIYREKCKKVNGADNATFYEEIERAAAKMSTCISGVVN
LTALQEEMDVARPNGDLDTVFSKYCLKAPEAEACVKEFNDKAQHCLTPEE
KRHQETVTRIGASVLGFACSRGGDQIALFIAEQGPECLEANKEAISNCLN
QSFHQYIPKDGQVPDLMSRPELLFSPTHCVDLQRFEACVIHHLEQCTQIT
TANIVQSVFRFVKNETDCQAWMQARANEKPILMAASSNNTAPGLAYSLAG
TLLGATILLILPASFLDH

BO29151.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-PC 312 CG11378-PC 1..312 1..312 1614 100 Plus
CG11378-PB 312 CG11378-PB 1..312 1..312 1614 100 Plus
CG11378-PA 312 CG11378-PA 1..312 1..312 1614 100 Plus
CG14629-PA 319 CG14629-PA 17..315 13..308 571 40.2 Plus
CG9917-PB 301 CG9917-PB 9..273 14..288 506 38.6 Plus