Clone BO29152 Report

Search the DGRC for BO29152

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG3355-RA
Protein status:BO29152.pep: Imported from assembly
Sequenced Size:976

Clone Sequence Records

BO29152.complete Sequence

976 bp assembled on 2011-08-26

GenBank Submission: KX796919

> BO29152.complete
GAAGTTATCAGTCGACATGCGCGTCTACCTGGCCCTGCCGCTCCTGCTGC
TGGGCATCGGCCTCAGTTTGGCCCAGTACCAGTATCAAGCGCCCCACCAA
ACCCTCGCCCAGCAATTCGCCGACGTGGTGGATGTGGTCGATCCTGCAGA
ACAATCTATCAAAGCAGTGCGACCACCGAAGAGCCGCAATCAGTGCACCG
CCAAGCAGAACTGCTTCTGCGGCACTCCGAATGTCAACCGTATCGTGGGC
GGCCAGCAGGTGCGCTCCAACAAGTATCCTTGGACCGCCCAATTGGTAAA
GGGTCGTCATTATCCCCGCCTCTTCTGCGGCGGTTCCCTAATCAATGATC
GCTATGTGCTGACCGCCGCCCATTGTGTGCATGGGAACAGGGATCAGATC
ACCATTCGCCTGCTCCAGATCGACAGATCCTCCCGGGATCCCGGCATTGT
GCGCAAGGTCGTCCAGACCACTGTGCATCCTAACTACGATCCCAACCGGA
TTGTCAACGATGTGGCGCTGCTCAAGCTGGAGTCCCCTGTTCCACTGACT
GGAAACATGCGTCCAGTCTGTCTGCCCGAGGCCAATCATAACTTTGATGG
CAAGACCGCTGTGGTTGCTGGCTGGGGTTTGATCAAGGAGGGCGGCGTCA
CCTCCAACTATCTGCAGGAGGTCAATGTGCCCGTCATCACCAACGCGCAG
TGTCGCCAGACGCGCTACAAGGACAAGATTGCCGAGGTGATGCTCTGCGC
CGGATTGGTGCAGCAGGGTGGCAAGGACGCCTGCCAGGGCGACAGTGGTG
GCCCACTGATCGTCAACGAGGGTCGCTACAAGCTGGCCGGCGTGGTGTCC
TTCGGCTACGGATGTGCACAGAAGAATGCGCCGGGTGTCTACGCCAGGGT
GAGCAAGTTCCTGGACTGGATCCGTAAGAACACCGCCGACGGCTGCTACT
GCCAGAGTGCAAGCTTTCTAGACCAT

BO29152.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-RA 945 CG3355-PA 1..942 17..958 4710 100 Plus
CG3355-RB 651 CG3355-PB 1..592 17..608 2960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-RA 1096 CG3355-RA 36..977 17..958 4710 100 Plus
CG3355-RB 1399 CG3355-RB 88..679 17..608 2960 100 Plus
CG3355-RB 1399 CG3355-RB 945..1295 608..958 1755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4651765..4652157 216..608 1965 100 Plus
2L 23513712 2L 4652423..4652773 608..958 1755 100 Plus
2L 23513712 2L 4651490..4651688 17..215 995 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:36:12 has no hits.

BO29152.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:45 Download gff for BO29152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 88..1029 17..960 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:03:18 Download gff for BO29152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 36..977 17..960 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:28 Download gff for BO29152.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 36..977 17..960 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:28 Download gff for BO29152.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4652423..4652773 608..960 99   Plus
2L 4651765..4652156 216..607 100 -> Plus
2L 4651490..4651688 17..215 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:03:18 Download gff for BO29152.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4652423..4652773 608..960 99   Plus
arm_2L 4651765..4652156 216..607 100 -> Plus
arm_2L 4651490..4651688 17..215 100 -> Plus

BO29152.pep Sequence

Translation from 16 to 976

> BO29152.pep
MRVYLALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDVVDPAEQSIKA
VRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYP
RLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIVRKVVQ
TTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVV
AGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQ
GGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLD
WIRKNTADGCYCQSASFLDH

BO29152.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-PA 314 CG3355-PA 1..314 1..314 1673 100 Plus
CG3355-PB 216 CG3355-PB 1..197 1..197 1046 100 Plus
CG4613-PC 374 CG4613-PC 122..372 58..312 834 60.7 Plus
CG4613-PB 374 CG4613-PB 122..372 58..312 834 60.7 Plus
CG18735-PA 364 CG18735-PA 58..321 43..312 630 47.1 Plus