Clone BO29155 Report

Search the DGRC for BO29155

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptImpL1-RA
Protein status:BO29155.pep: Imported from assembly
Sequenced Size:1057

Clone Sequence Records

BO29155.complete Sequence

1057 bp assembled on 2011-08-26

GenBank Submission: KX796391

> BO29155.complete
GAAGTTATCAGTCGACATGAGGCCATACCAAGTAGTTTGCATCGTAGCAG
TAGCAGCTCTGCTGCTTTTGGAGGCGATTCCCGCGGATGCAAAGCGGCGC
AAGCACAAGGGCTCCGATCATCACTATGAAAAGTCTGATCCCCACAAGAC
CAAGACAAAGACCAAGTGGTCTAGCTCCACGGATTTGGCTGGAAACACTC
CAATTTCCACCGAAGAGCACGGCTACTATGTAAAGCGCACCTTTGCGGCT
CCCGGTGAGATTGGAGCCGCACAGAAGCGTCTAAGTCCCCCCTATTTGGC
CATTCCCATCGCCTGGTTCAGCTGTGAGTCGGGCCAGAAGAATTGCCAGT
CTTCCAATTCCGCGGCTATCAACAGTGCCGCGCAGTCCTTGAGCGAGGGC
TATCTGTGCGACGATGATTGCGATGAACTGTACGAGCCCATCTGCGGCAG
GACCACCTCAGAGGTGGCCGTTTTCTACAACAAGTGCAAGTTGGGTGTAG
CCAAGTGCCGATCCCACGGTCTTTGGACGGACTTCGCCTATGCCGAGTGC
CAGGCGAAATATCCGCAGGAAACTGCCTATGCCGACAAGAAGTTCCGGTC
ATCGCCTTATTTCCGGGATGCGGCCATCGTGGAGCAATTGAAGCTGGAGG
AGGAGAAGCGTAAGCAGGAGGAGGAACAACACAAGCTGGAGAAGGAGCAA
AAGAAGAAGGAGAAGGCTGAGAAAAATAAGAACGAGAAGGACAGCAGCGA
AAGCAGCGAGGAGAAGGATGACCAAAAGGAAAACAAGCAGAAGGATCCCC
TTTCCCTAATGCCACAGAAGAAAGTGGAATCCACCCAGAAGCCAGTGCCA
GTTCCTATTCAAGTAGCAGTTCCAAAACCAGTTTCAGTTTTGGAGCCTGC
AAAGACGACCGAGGACATCGCTATGCCGCCTATGCCACTGAAGGACACTC
CCACGCCCAAACCTCTGGAGATCGCGCCCCTTCACCAGCAGACCCAACCC
AAGGGCAAGGACATTGATAGGCTCAAGTACCAAGTAGCTGCAAGCTTTCT
AGACCAT

BO29155.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-RA 1026 CG10717-PA 1..1023 17..1039 5115 100 Plus
ImpL1-RC 1023 CG10717-PC 1..1020 17..1039 5035 99.7 Plus
ImpL1-RB 1101 CG10717-PB 104..1098 45..1039 4975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-RA 1160 CG10717-RA 39..1063 15..1039 5125 100 Plus
ImpL1-RC 1157 CG10717-RC 39..1060 15..1039 5045 99.7 Plus
ImpL1-RB 1230 CG10717-RB 139..1133 45..1039 4975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13382908..13383902 45..1039 4975 100 Plus
Blast to na_te.dros performed 2014-11-27 00:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 8767..8891 641..759 117 56.8 Plus

BO29155.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:45 Download gff for BO29155.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 49..1071 17..1041 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:33:16 Download gff for BO29155.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 41..1063 17..1041 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:08:56 Download gff for BO29155.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL1-RA 41..1063 17..1041 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:08:56 Download gff for BO29155.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13382911..13383902 48..1041 99   Plus
3L 13382805..13382835 17..47 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:33:16 Download gff for BO29155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13376011..13377002 48..1041 99   Plus
arm_3L 13375905..13375935 17..47 100 -> Plus

BO29155.pep Sequence

Translation from 16 to 1057

> BO29155.pep
MRPYQVVCIVAVAALLLLEAIPADAKRRKHKGSDHHYEKSDPHKTKTKTK
WSSSTDLAGNTPISTEEHGYYVKRTFAAPGEIGAAQKRLSPPYLAIPIAW
FSCESGQKNCQSSNSAAINSAAQSLSEGYLCDDDCDELYEPICGRTTSEV
AVFYNKCKLGVAKCRSHGLWTDFAYAECQAKYPQETAYADKKFRSSPYFR
DAAIVEQLKLEEEKRKQEEEQHKLEKEQKKKEKAEKNKNEKDSSESSEEK
DDQKENKQKDPLSLMPQKKVESTQKPVPVPIQVAVPKPVSVLEPAKTTED
IAMPPMPLKDTPTPKPLEIAPLHQQTQPKGKDIDRLKYQVAASFLDH

BO29155.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL1-PA 341 CG10717-PA 1..341 1..341 1797 100 Plus
ImpL1-PC 340 CG10717-PC 1..340 1..341 1781 99.7 Plus
ImpL1-PB 366 CG10717-PB 1..366 1..341 1761 93.2 Plus