Clone BO29157 Report

Search the DGRC for BO29157

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:291
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG42542-RG
Protein status:BO29157.pep: Imported from assembly
Sequenced Size:973

Clone Sequence Records

BO29157.complete Sequence

973 bp assembled on 2011-08-26

GenBank Submission: KX796749

> BO29157.complete
GAAGTTATCAGTCGACATGTTGCACTCAACTTTGATTTGTGCCACGCTCC
AAGCGCAGTTACTGCGCAAGGCCAGCCGCAAGTACGAGGACGCGGAGGGC
AAGCGAAAGAATAGCAACTCGGACAAGGAGGATGCCAGCGAACAGGCGCT
TATCCATGGCCGCAACTCCATTTCCACGGCGGCAGGTTCCACCACGGACA
TGCAGCATCGCCAGCGGAAACAGCGCAATCATCTCAATAACAATAATAGT
AAGCAAAATAGCTGTGATAAAACTGGCAACGATGACGACGACCGGGATCA
GCACGAATCGGAGGTGTTCCTCAAGGAGGGCGGCCGCATTGTCGAGCAGC
TCAAGTTAAAGACCTTCCCCAGCAGCCCGGCCCACTCGGCGGCCTCATCG
AACCAGACCGAACAAACCAACTCTATTGCCGCCTCCACCGCCACCGTAGA
TGTCCAGCTGGCTGGCCATCCCACCGACCCGTCCGTAGGTGGCGCCTCGG
AGCCACGTGCTCCGCTGGCCGGACACGATAGCATGCACAGTCTCAATGGC
AGCCTAAACGGAGAATCCGGACCGGTGAATGGCGCTCTCAAAGCACGGCT
GGATCGTGATGTGAACGCGGCGCTGGTGAATGACGCCGAGAGCGGTCGTC
GTCGTCCACAGAAACGGGGTGCCACCTACTTCACCATGCGCATCCTGGCC
CAGGCCTTCACAATGACGTTCCTGGCCGAGTGGGGCGATCGCTCCCAACT
GACCACCATTATTCTCGCCGCTAGCAAGGACGTTTACGGCGTTATCGCTG
GCGGTATTATTGGCCACTGCATCTGCACCGGCCTGGCTGTGATTGGTGGT
CGTCTCGTGGCTTCCAAAATCTCAGTGCGCACTGTCACCATTGTGGGTGG
CATTGTGTTCATCGGATTCGCCATCTACGCTGTCGCCATACCTCCGGATG
ACATTGCAAGCTTTCTAGACCAT

BO29157.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-RG 942 CG42542-PG 1..939 17..955 4695 100 Plus
CG42542-RD 1512 CG42542-PD 611..1509 57..955 4495 100 Plus
CG42542-RE 1512 CG42542-PE 611..1509 57..955 4495 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-RG 1550 CG42542-RG 81..1019 17..955 4695 100 Plus
CG42542-RD 2215 CG42542-RD 782..1680 57..955 4495 100 Plus
CG42542-RE 2190 CG42542-RE 757..1655 57..955 4495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15200644..15201225 17..598 2910 100 Plus
3R 32079331 3R 15202023..15202204 598..779 910 100 Plus
3R 32079331 3R 15202264..15202442 777..955 895 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:46:28 has no hits.

BO29157.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 13:54:46 Download gff for BO29157.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 86..1019 22..957 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:33:35 Download gff for BO29157.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 86..1019 22..957 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:09:11 Download gff for BO29157.complete
Subject Subject Range Query Range Percent Splice Strand
CG42542-RG 86..1019 22..957 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:09:11 Download gff for BO29157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15202266..15202442 779..957 98   Plus
3R 15202024..15202203 599..778 100 -> Plus
3R 15200649..15201225 22..598 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:33:35 Download gff for BO29157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11027988..11028164 779..957 98   Plus
arm_3R 11027746..11027925 599..778 100 -> Plus
arm_3R 11026371..11026947 22..598 100 -> Plus

BO29157.pep Sequence

Translation from 16 to 973

> BO29157.pep
MLHSTLICATLQAQLLRKASRKYEDAEGKRKNSNSDKEDASEQALIHGRN
SISTAAGSTTDMQHRQRKQRNHLNNNNSKQNSCDKTGNDDDDRDQHESEV
FLKEGGRIVEQLKLKTFPSSPAHSAASSNQTEQTNSIAASTATVDVQLAG
HPTDPSVGGASEPRAPLAGHDSMHSLNGSLNGESGPVNGALKARLDRDVN
AALVNDAESGRRRPQKRGATYFTMRILAQAFTMTFLAEWGDRSQLTTIIL
AASKDVYGVIAGGIIGHCICTGLAVIGGRLVASKISVRTVTIVGGIVFIG
FAIYAVAIPPDDIASFLDH

BO29157.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42542-PG 313 CG42542-PG 1..313 1..313 1592 100 Plus
CG42542-PD 503 CG42542-PD 204..503 14..313 1524 99.7 Plus
CG42542-PE 503 CG42542-PE 204..503 14..313 1524 99.7 Plus
CG42542-PF 323 CG42542-PF 205..323 195..313 597 100 Plus
CG42542-PC 323 CG4196-PB 205..323 195..313 597 100 Plus